KEGG   Listeria weihenstephanensis: UE46_08210Help
Entry
UE46_08210        CDS       T05637                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00010  Glycolysis / Gluconeogenesis
lwi00350  Tyrosine metabolism
lwi00620  Pyruvate metabolism
lwi00625  Chloroalkane and chloroalkene degradation
lwi00626  Naphthalene degradation
lwi00650  Butanoate metabolism
lwi01100  Metabolic pathways
lwi01110  Biosynthesis of secondary metabolites
lwi01120  Microbial metabolism in diverse environments
lwi01130  Biosynthesis of antibiotics
lwi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UE46_08210
   00620 Pyruvate metabolism
    UE46_08210
   00650 Butanoate metabolism
    UE46_08210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UE46_08210
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UE46_08210
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UE46_08210
   00626 Naphthalene degradation
    UE46_08210
Enzymes [BR:lwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UE46_08210
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     UE46_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AQY51028
UniProt: A0A1S7FUB0
Position
complement(1695252..1697852)
Genome map
AA seq 866 aa AA seqDB search
MAMKEKAVNEEVEVQKVIDKLASNGQSALKAFADFDQEKVDNIVHAMALAGLDQHMPLAK
LAIEETGRGIYEDKCIKNIFATEYIWNSIKADKTVGIIHEDKQTGVVEIAEPVGVIAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQKCSSEAARVVYEAAVAAGAPEHCIQWVE
KPSLEATKQLMNHKDVALVLATGGAAMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRAV
NDLILSKTFDHGMICASEQAVIVDKEVAKAVKDEMEANKCYFVKGAEFKKLESYVINPET
HALNPNVVGKSPAWIANEAGFKVPEDTKMLVAEIKGVGDDYPLSHEKLSPVLAFIEAKDQ
AQAFDRCEEMLVYGGLGHSAVIHSTDREAQLAFGLRMKACRIIVNAPSAQGGIGDLYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIAERRNNMQWFKLPPKVFFEKYSTQYLQKM
PNIERVFIVTDPGMVQFKYVDVVIEHLKKRSNNVDIQVFADVEPDPSDVTVYKGAELMKD
FKPDCIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGEKAQFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVMTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSLRAIEMVFESLRASVLEGDEDAREKMHNASAMAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNATKPRKHALFPRYESYRADQDYAQ
IARVLGLPASTTEEGVKSLVDAIISLGKDCGIEMSLKGQNVDKKAFDAVVDTLADRAFMD
QCTTANPVQPLVSELKEVYMNAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaaagaaaaagctgtaaatgaagaagtagaagttcaaaaggtaattgataaa
ttagcaagtaatggacaaagcgcactgaaagcattcgctgactttgaccaagaaaaagta
gataatatcgttcatgcaatggcactagctggtcttgatcaacatatgcctcttgctaaa
ctagcgattgaagaaactggtcgcggtatttatgaagataaatgtatcaaaaatattttt
gcaacagaatatatttggaatagcattaaagcagataaaacagtcggcattatccatgaa
gataaacaaaccggtgttgttgagattgcagaaccagtcggcgttattgctggggtaact
cctgtaactaacccaacttctactacactatttaaagctatcattgctattaaaacacgt
aacccaatcattttcgcattccacccaagcgctcaaaaatgttcttctgaagccgctcgt
gttgtttatgaagcagcagttgcagcaggcgctccagaacattgtattcaatgggttgag
aaaccatcactagaagcgacaaaacaattgatgaaccataaagatgtagcgctcgtgctt
gctacaggtggtgcagcaatggttaaatcagcgtactctactggtaaacctgctcttggc
gttggtcctggtaacgttccagcttacatcgacaaaacagcgaaaatcaaacgcgcagta
aacgacctaatcctatctaaaactttcgatcacggtatgatttgtgcttctgaacaagct
gtcatcgtcgacaaagaagttgccaaagctgtaaaagacgaaatggaagcgaacaaatgc
tacttcgttaaaggcgctgaattcaaaaaattagaaagctatgttatcaatcctgaaaca
cacgcgttaaatccaaatgttgtaggtaaatcccctgcttggatcgcaaacgaagctgga
ttcaaagttccagaagatacaaaaatgctcgtagctgaaattaaaggtgtgggcgacgat
tacccactatctcatgaaaaactaagcccagtcctagctttcattgaagcgaaagaccaa
gcacaagcttttgatcgttgtgaagaaatgcttgtatacggtggtttaggtcactcagca
gttattcattcaacagaccgcgaagcacaactagcattcggtttacgtatgaaagcatgt
cgtatcattgtgaacgcaccatctgctcaaggcggaatcggcgacctttacaatggcttc
atcccttccctaacactaggttgcggatcttacggtaaaaactctgtatcacaaaacgtt
agcgcaacaaaccttttaaatgtgaaacgtatcgcagaacggagaaataatatgcaatgg
ttcaaactgccaccaaaagtattctttgaaaaatattctacacaatatctacaaaaaatg
ccgaacatcgaacgcgtattcatcgtaactgacccaggaatggtgcaattcaaatatgtt
gacgttgttatcgaacacttgaaaaaacgcagtaacaatgtagacattcaagtatttgca
gacgtagaaccagatccatctgacgtaactgtttataaaggcgcagaactaatgaaagac
ttcaaaccagattgcattatcgcactcggtggtggttccgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggtttgaaacaaaaattctta
gatattcgcaaacgtacattcaaatatcctaaacttggtgaaaaagcgcaattcgttgcc
atccctactacatctggtactggatctgaggttactccttttgcggttattacagataaa
gaaaacaacattaaatacccacttgcagattacgaattgactccagacgtagcaattgtc
gatgcacaatatgtgatgacagttccagctcacatcacagctgacacaggtatggacgta
ttaacacatgcgatcgagtcatacgtatccgtaatggcaagcgattatactcgtggattg
tctctacgtgccattgaaatggtattcgaatcattacgcgcttccgttcttgaaggtgac
gaagatgctcgtgaaaaaatgcataatgcttccgctatggctggtatggcatttgccaac
gctttcctaggaattaaccatagtttagctcacaaaatcggacctgaattccatatccct
catggtcgtgcgaatgctatccttatgccacacgttattcgttacaatgcaacaaaacct
agaaaacatgcgttgttcccaagatacgaatcttaccgcgcagaccaagattacgcacaa
attgctcgcgtactagggcttccagcttctacaacagaagaaggcgtgaaatcactagtt
gatgcaatcatcagccttggtaaagattgcggaatcgaaatgagcttgaaaggtcaaaac
gttgacaagaaagcattcgacgcagtggttgatacacttgctgatcgcgcgttcatggat
caatgtacgactgctaacccagttcaaccgctcgtttccgagttgaaagaagtttatatg
aacgcttataaaggtgtttaa

DBGET integrated database retrieval system