KEGG   Listeria weihenstephanensis: UE46_09660Help
Entry
UE46_09660        CDS       T05637                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00020  Citrate cycle (TCA cycle)
lwi00480  Glutathione metabolism
lwi01100  Metabolic pathways
lwi01110  Biosynthesis of secondary metabolites
lwi01120  Microbial metabolism in diverse environments
lwi01200  Carbon metabolism
lwi01210  2-Oxocarboxylic acid metabolism
lwi01230  Biosynthesis of amino acids
Module
lwi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UE46_09660
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UE46_09660
Enzymes [BR:lwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UE46_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AQY51295
UniProt: A0A1S7FVC4
Position
complement(1998527..1999795)
Genome map
AA seq 422 aa AA seqDB search
MTQGEKIQVVDGALKTPNNPVIPFIEGDGTGPDIWRASKRVLDAAVAKAYNGEKEIAWKE
VLAGQKAFDQTGEWLPQATLDTIDEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGSDEAKKLIAFLKDEFGVDKIR
FPETSGIGVKPISKEGTERLVRAAIEYAIKENRKSLTLVHKGNIMKFTEGAFKTWGYELA
EREFGDKVFTWSEYDRIVETDGVDAANAKQDAALAAGKILVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYANLDKVNPS
SVILSGTLLLEHIGWGEAADLIIKSMEKTIADKTVTYDFARLMDGATEVKCSEFADALIR
NF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgacacaaggtgagaaaattcaagtagtagacggtgctttaaaaacaccaaataatcca
gtcattccattcatcgagggagacggcacaggtccagacatttggcgtgcttctaaacgc
gtacttgatgctgcggttgcaaaagcttacaatggcgaaaaagaaatcgcttggaaagaa
gttttggcagggcaaaaagcgttcgatcaaacgggagaatggttgccacaagcgacgtta
gatacaattgatgaataccttattgcgatcaaaggacctctaacaacaccgattggtggc
ggaattcgttcgttaaacgtggcattacgacaagagttagatctttatgtgtgccttcgc
ccagtgcgctattttacaggcgttccttctccagtgaagcgtcccgaagatacggatatg
gtgatttttcgtgaaaacacagaggacatttatgcaggaattgaatttaaagaaggcagc
gatgaagcgaaaaaactgattgcgttcctaaaagatgaatttggtgtggataaaatccgt
ttcccagaaacatcaggaattggcgtgaaacctatttctaaagaaggaacagaacgcttg
gttcgcgcagctattgaatacgcgatcaaagaaaatcgtaaatcattaacacttgtccat
aaagggaatatcatgaaattcacagaaggtgctttcaaaacgtggggctacgaacttgct
gaacgcgagtttggtgataaagtcttcacttggtcagaatatgatcgcattgttgaaaca
gacggtgtggacgcagctaacgcgaaacaagacgcagcgcttgcagctggcaaaattctt
gtgaaagattcgattgcagatattttcttacaacaaatcctgacgcgtccagcggaattt
gatgttgtggcaacgatgaatctgaacggagattacatttcagatgcactggcagctcaa
gtcggtggtatcgggattgcacctggtgcgaatattaactacctaacagggcatgcgatt
tttgaagcaacacatggcacagcgccaaaatatgcgaacttagataaagtgaacccatcg
tcggttatcctttctggaacgctattattggaacatatcggctggggtgaagcggcagat
ctgatcattaaatcgatggaaaaaacaattgctgataaaacagtgacgtatgatttcgct
cgtttaatggacggcgcaacagaagtaaaatgttctgagtttgcagatgctttaattcgc
aacttttaa

DBGET integrated database retrieval system