KEGG   Listeria weihenstephanensis: UE46_12400Help
Entry
UE46_12400        CDS       T05637                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lwi  Listeria weihenstephanensis
Pathway
lwi00051  Fructose and mannose metabolism
lwi01100  Metabolic pathways
lwi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UE46_12400
Enzymes [BR:lwi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     UE46_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AQY51755
UniProt: A0A1S7FWP3
Position
complement(2560195..2560845)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKVVKVMFDRFETNAAGGNVSVRMNEEHIIMTPTLMSQARLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPEIGCVLHAHPKESMLFATLGMELPNLTEAT
QKLGVIPTLDFAPATSPELAEIVRKHVIALGKDAVPSASLLNKHGIVVLDTSLHKAYDLL
ERIEYNAYIAEKALVFDALNIKKLEQDMALNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttatatcaaaaagaacgtgaagatttagcaaaagtagtaaaggtgatgtttgaccgg
tttgaaacgaacgccgcgggtggaaatgtatcggtgcgtatgaatgaagaacacattatc
atgacaccaacgttgatgagtcaagcccggttatgcgacttgtcgccttatgaaattctg
gtggtagataacaataatgaggtagtggaaggcgatggacgggtaacgcgtgagatcaat
ttgcaccgggcttgctacgttgaaaatccagagatcggttgtgtgcttcatgcgcatcca
aaagaatcaatgttgttcgcgacgctcggaatggagctgccaaacttaacagaagctacg
caaaaattaggcgtcattccaacacttgattttgcaccagcaacaagccccgagttagct
gaaattgttcgtaagcatgttattgcgctcggaaaagacgctgtaccaagcgcaagtctg
cttaataaacacggaatcgtcgttctagatactagtttacacaaagcatacgatctacta
gaacgcatcgagtacaacgcctatatcgccgaaaaagcgcttgtttttgatgctttaaat
atcaagaaattagaacaggatatggctctgaactacaacttagaggagtag

DBGET integrated database retrieval system