KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx01110Help
Entry
Lxx01110          CDS       T00190                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00860  Porphyrin and chlorophyll metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lxx01110 (hemD)
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Lxx01110 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAT88195
UniProt: Q6AHF0
Position
108834..109616
Genome map
AA seq 260 aa AA seqDB search
MTTGSVPKPLAGWRVLVPRGGPWGDSVAADLRAVGASPVVAAMINFAPAADASALERALH
RLAAGEFDWVTITSATTVDVLSASRAVVPPRTRIAAVGETTAAALTAASYKMDLVPAEDN
SAHGLLAEWEAATQGQVPLRILTLRSDIAKPLLTEGLRRIGHDVDSVVAYRTIGVTVPES
VVADVRQGLVQAILVTSGSVAEQVQLQLGPIPESTLVAAIGPRTARDARDCGLRVDVVAE
ERTAAALIQAVVAVAASRVG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgggatcggtgccgaaaccgctcgccggctggcgtgttctggtcccgcgcggg
gggccgtggggcgactccgtggcggcggatctgcgagcggtgggcgcttcgccggtcgtc
gcggccatgatcaatttcgcgccggcggccgacgcctccgctctggagcgcgctctgcac
cgcctggccgccggcgagttcgactgggtgacgatcacgagcgcgaccacggtggatgtg
ctgagcgcgtcccgcgcggtcgtcccgccccgcacacggatcgccgccgtcggagagacc
acagccgctgcgctcaccgcggccagctacaagatggacctcgtgcccgcggaggacaac
tccgcccacggactgcttgcggagtgggaagccgcaacccagggccaggtcccgttgcgc
atcctcacgctccgttccgatatcgccaagcctctcctcaccgaggggttgcgccgtatc
gggcacgacgtcgattcggtcgtggcctaccgcacgatcggcgtgaccgtgccggagagc
gtggtcgcggatgtgcggcaggggctcgtgcaggcgatcctcgtcacgagcggctcggtg
gccgagcaggtgcagctgcagctcggccccattccggagtccacgctggtcgcggccatc
ggaccgcggacggcgcgcgacgcccgcgactgcggtctgcgggtggatgtcgtggccgag
gagcgcaccgccgccgcgctgatccaggcggtcgtggcggtggccgcctcccgtgtgggc
tga

DBGET integrated database retrieval system