KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx01120Help
Entry
Lxx01120          CDS       T00190                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00860  Porphyrin and chlorophyll metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lxx01120 (hemB)
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Lxx01120 (hemB)
Exosome [BR:lxx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lxx01120 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD BMC OMS28_porin
Motif
Other DBs
NCBI-ProteinID: AAT88196
UniProt: Q6AHE9
Position
109644..110624
Genome map
AA seq 326 aa AA seqDB search
MSELHPVIRPRRLRQSPAMRRLVAETRLHPAELILPLFVREGLAEPRPVASMPGVVQHTL
DSLSRAASGAAEAGVGGVMLFGVPEMRDAAGSAATDPDGILNVATRTVAAEVGDALVVQT
DLCLDEFIDHGHCGVLDGAGAVDNDATLLRYRDMALAQVEAGSQLLGLSGMIDGQVAAVR
QALDAAGHTETVLLAYAAKYASGFYGPFRDAVDSPLVGDRRAYQQDPANRREGLREARLD
LDEGADILMVKPALSYLDVLSDVAAISEVPVWAYQVSGEYAMVEAAAANGWIDRDRIIEE
TLVGARRAGADAIVTYWATEVAGWQR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactgcaccccgtcatcagaccccgccgtctgcggcagtcgccggcgatgcgg
cgtctcgtggccgagacccggctgcaccccgccgagctgatcctccctctcttcgtgcgc
gagggcctggccgagccgcggccggtcgcgtcgatgccgggcgtggtccagcacacgctg
gactcgctgagtcgtgccgcctccggcgcggctgaggcgggcgtcggtggcgtcatgctg
ttcggtgtgccggagatgcgcgacgccgccggctccgccgcgaccgaccccgacggcatc
ctgaatgtcgcgacccgcactgtcgccgccgaggtgggcgacgcgctcgtcgtgcagacc
gatctgtgcctggacgagttcatcgaccacggccactgtggggtgctcgacggagccgga
gccgtcgacaacgacgcgactctgctgcgctaccgcgacatggcgctcgcgcaggtcgag
gccggctcccagctgctcggcctcagcggcatgatcgacggtcaggtcgccgccgtgcgc
caggcgctcgacgcggccggtcacacggagacggtgctcctcgcctatgctgccaagtac
gcttccggcttctacggccccttccgcgacgctgtcgactccccgctggtcggcgaccgc
cgtgcctatcagcaggacccggccaaccgccgagagggtctgcgcgaggcccgcctcgac
ctggacgagggtgcggacatcctcatggtgaagccggcgctgagctacctcgacgtgctc
agcgacgtcgccgccatcagcgaggtcccggtctgggcctaccaggtctccggcgagtac
gcgatggtggaggccgccgccgcgaacggctggatcgaccgcgaccggatcatcgaggag
acgctggtcggcgcccgccgcgcgggggccgatgcgatcgtgacctattgggcgaccgaa
gtggcggggtggcagcgatga

DBGET integrated database retrieval system