KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx01130Help
Entry
Lxx01130          CDS       T00190                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00860  Porphyrin and chlorophyll metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lxx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lxx01130 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lxx01007]
    Lxx01130 (hemL)
Enzymes [BR:lxx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Lxx01130 (hemL)
Amino acid related enzymes [BR:lxx01007]
 Aminotransferase (transaminase)
  Class III
   Lxx01130 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AAT88197
UniProt: Q6AHE8
Position
110645..111988
Genome map
AA seq 447 aa AA seqDB search
MAAAAIGEANLAQFGRAQRVIPGGVNSPVRAFRSVGGTPRFMVFANGPYIVDAEGREYVD
LVASWGPAILGHAHPAVVSAVQEAAARGLSFGASTPAETELAEAVIARVPFVEKLRLVST
GTEATMTAIRLARGFTGRPLLIKFAGHYHGHSDSLLAEAGSGLATLSLPGSAGVTEATAA
QTLVLPYNDLGAVRAVFEANGPDIAAVIAEAAAANMGVVPPDEGFNAALTDLAHEYGALL
ILDEVLTGFRVSEAGFWGLDRGYTPDLVAFGKVIGGGMPLAAVGGRAELMDILAPAGPVY
QAGTLSGNPVAVAAGLATLAHAGEAVYDRLDIVAGTLSAAVSDALTAEGVAHSVQRAGNL
FSFVFGDVAAAPRTFAEVQRQEAFRYRAFFHAMLDAGVSLPPSVFEAWFVTAAHDDAAVG
RVLEALPAAARAAASACPGRPLLFVRR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
ttggccgccgccgcgatcggggaggccaacctcgcgcagttcgggcgcgcgcagcgggtc
atccccggcggcgtgaactcgccggtgcgcgcgttccgctccgtcggcgggacgccgcgg
ttcatggttttcgcgaacgggccgtacatcgtggacgccgaaggacgtgagtacgtcgac
ctcgtcgcgtcgtgggggccggccattctggggcacgcgcatcccgccgtggtctccgct
gtccaggaggccgccgcgcgcggtctctcgttcggcgcctcgaccccggccgagaccgaa
ctggcggaggcggtgatcgctcgggtcccgttcgtggagaagctacggctcgtctccacc
ggcacggaggcgacgatgaccgccatccggctcgctcgcggtttcaccggccgcccactg
ctgatcaagttcgccgggcactaccacggccactccgacagcctcctcgcggaggcgggc
tccggtctcgccacgctctcgctgcccggctcggccggggtcactgaggcgacggccgcg
cagaccctggtgctcccgtacaacgacttgggggccgtgcgtgccgtcttcgaggcgaac
ggtcccgacatcgccgcggtcatcgccgaggccgccgccgcgaacatgggcgtcgtcccg
ccggacgagggcttcaacgccgcgctgaccgacctcgctcacgagtacggggccctcctc
atcctcgatgaggtgctgaccggtttccgcgtgagcgaggccgggttctggggtctcgac
cgcggctacacccccgacctcgtcgccttcggcaaagtcatcggcggcgggatgccgctc
gccgcggtcggcggacgggccgagctgatggacatcctcgccccggccggccccgtttac
caggccggtacgctctccggcaacccggtcgctgtcgccgccggtctcgcaacgctggcc
cacgccggcgaggcggtctacgaccggttggacatcgtggccggcaccctctccgccgcc
gtctccgacgccctcaccgccgagggcgtcgcccacagcgtgcagcgggccggcaacctc
ttcagcttcgttttcggcgacgtcgccgccgctccgcgcactttcgccgaggtgcagcgg
caggaggcgttccgctatcgggccttcttccacgcgatgctcgacgcgggggtgtccctg
ccgccgagcgtgttcgaggcgtggttcgtgaccgccgcgcacgacgatgcggctgtgggc
cgcgtcctcgaagcgttgcccgctgctgcgcgggcggcggcctcggcctgccccggacgt
ccgctgctattcgtccgccggtga

DBGET integrated database retrieval system