KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx02530Help
Entry
Lxx02530          CDS       T00190                                 

Gene name
poaA
Definition
(GenBank) proline dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00250  Alanine, aspartate and glutamate metabolism
lxx00330  Arginine and proline metabolism
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lxx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lxx02530 (poaA)
   00330 Arginine and proline metabolism
    Lxx02530 (poaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lxx03000]
    Lxx02530 (poaA)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Lxx02530 (poaA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Lxx02530 (poaA)
Transcription factors [BR:lxx03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Lxx02530 (poaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Glyoxalase_6
Motif
Other DBs
NCBI-ProteinID: AAT88297
UniProt: Q6AH48
Position
255026..258733
Genome map
AA seq 1235 aa AA seqDB search
MSTDSDGRHPAQAVRNTVVDMVESRDVAASRLADEAVELVRSWLAQSAGRGGETVHEDPA
AERLAGVLRDPDGLEFAVGFVDGVARPQDLFVAGYNLQRVAKKIPAFLPWYMRFAIWLGG
VFGPVLPWVVIPIARRVLRRMVGHLVVDATPEKLGPAIAHLRAPHDPAGHGARLNLNLLG
EAVLGEREAARRLKGTRALLARDDVDYVSIKVSSIASQLSMWSFDETVARVVERLTPLYQ
LAASSPTPTFINLDMEEYRDLDLTMAVFTGVLSKPEFLRLEAGIVLQTYLPDALDALQRL
TEWATERRIAGGAPIKVRVVKGANLAMERVDAAIHGWPLATYSSKQATDANYKRVLDWAL
RPEHTDAVKIGVAGHNLFDVAFAWLLASRRGVAERIDVEMLLGMATAQAEAVKRTVGELL
LYTPVVNPAEFDVAISYLIRRLEENASPENFMSAVFELGSDPELFERERQRFLASVAEFE
ADALSHEAAPLPNRTQDRTREWEESTADAFTRPPADDPVAGAADEGLTSVVLGLTRGSSG
GLEADGAVGERTSRDEGRSGFENAADTDPSLAANRAWGRRILSRSGASELGAAAIASAAV
SEPATLDGLLESVRAAGAAWGARSGKERAGLLDRAGHALEANRDRLIEVMAAETGKTIAE
ADPEVSEAVDFAHYYATLARELDSIQGARFVPSQLTVVVPPWNFPVAIPAGGVLAALAAG
SGVIVKPAPQAKRSGAVMVEALWEAGIPRELLVLVDIGEDELGQQLVADARVDRVILTGS
YETAKLFRSWRPDLPLLAETSGKNAIIVTPSADYDLAVSDIVKSAFGHAGQKCSAASLVI
LVGSVAKSERFRNQLVDAATSLRVGYPQDPMSQMGPLIEPASGKLLHALTTLGADEDWLV
QPKQLDGSGRLWSPGIRTGVQPGSYFHLTEFFGPVLGIMTARTLEEAVRYQNAIEYGLTA
GLHSLDSEELAQWLDTVEAGNLYVNRGITGAIVRRQPFGGWKRSAVGAGAKAGGPNYLIG
LGSCEPDLGQSSSSLHLRGLEQRVTDLIESGQSSMGYPAFDLVRRSALSDAIAMATEYHQ
VRDVSGLGAERNLFRYLPVPVTIRLSEGASLPELLRVMASATVARSRFSVSTSVKLPRGT
AHLLREREVEVVVESDAHWLSRVRAQRIPDHRIRLIGGDPAELAAALGGIPDVAVYSGLV
TPSGRVEVLPFLHEQAISITNHRFGNPTRSTEEAI
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacagattcggacggtcggcatcccgcccaggcagtgaggaatacagtcgtggac
atggttgagagcagggacgtggccgcgagccgattggccgatgaggcggtcgagctcgtg
cgctcgtggctcgcgcagagcgcggggcgcggtggggagacggtccacgaggacccggcg
gccgagcgtctggcgggtgtgctgcgcgatccggacggcctggaattcgcggtcgggttc
gtagacggggtggcccggcctcaggacctcttcgtcgcggggtacaacctgcagcgcgtc
gcgaagaagattccggcgttcctgccctggtacatgcggttcgcgatctggctgggcggt
gtcttcggcccggtgctgccgtgggtggtcattccgatcgcgcgccgcgtgcttcggcgg
atggtcggccatctcgtcgtggacgcgacgcccgagaagctcgggcccgccatcgcgcac
ctgcgcgcaccccacgacccggccggccatggcgcgcgcctgaacctcaacctgctcggc
gaggcggttctcggggagagggaggcggcgcggcggctgaaaggcactcgtgcgctgctg
gcccgggacgacgtcgactatgtctcgatcaaggtgtcgtcgatcgcctcccagctgtcg
atgtggtcattcgatgagacggtcgcacgtgtcgtcgagcggctgacgccgctctaccag
ctggccgcgtcgtcgccgacgccgacgttcatcaacctcgatatggaggaatatcgcgat
ctcgacctcacgatggcggtgttcactggcgtcctgagcaagccggagttcctccgtttg
gaggcggggatcgtgctccagacttacctcccggacgcgctcgacgcgcttcagcggctc
acagaatgggcgaccgaacgacggatcgcgggcggcgctccgatcaaggtgcgggtcgtg
aagggcgcgaacctggcgatggagcgggtggatgccgcgatccacggctggccgctggcc
acctacagcagcaagcaggcgaccgacgcgaactacaagcgtgtgctggactgggcgctg
aggccggagcacaccgatgctgtgaagatcggcgtcgcgggacacaacctgttcgacgtc
gccttcgcgtggctcctcgcctctcggcgcggggtcgccgagcggatcgacgtcgagatg
ctgctcgggatggcgacggctcaggcggaggccgtgaagcggacggtcggagagctgctg
ctgtacacgccggtggtcaatccggccgagttcgatgtcgcgatctcgtacctcatccgc
cggctggaggagaacgcgagcccggagaacttcatgtcggcggtgttcgagctcgggtcg
gaccccgagctgttcgagcgtgagcggcagcgcttcctcgcctcggtggcggagttcgag
gcggatgccttgtcgcatgaagcagcaccgcttccgaaccgcacacaggatcgcacccgg
gagtgggaggaatcgacggcggacgccttcacacggccaccggcggacgacccggtggcg
ggagctgcggacgagggcctgacgagcgtggtgctcggcctcacccgcgggtcgagcggc
ggcctggaggctgacggcgccgtcggggagcggacgagccgagatgaggggcgctcgggg
ttcgagaacgccgctgacaccgatccctcgctcgcagccaaccgggcgtggggccgccgc
atcctgagccggtcgggggcgagtgagctcggggccgcggcgattgcgagtgcggctgtc
agcgaaccggcgacgctggacggccttctcgaaagcgtgcgcgcggcaggggccgcgtgg
ggggcgcgcagcggcaaggagcgcgccggcctcctcgatcgggccgggcacgcgctggaa
gccaatcgggaccgcctgatcgaagtgatggcggccgagaccggcaagaccatcgcggag
gccgatcccgaggtgagcgaggcggtggacttcgcccactactacgcgaccctcgcgcgt
gagctcgacagcatccagggggcgcggttcgttccgtcgcagctcacggtggtcgttccg
ccctggaacttcccggtcgccatcccggcgggcggagtcctcgcggcgctcgccgcaggc
agcggggtgatcgtcaaaccagcgccgcaggcgaagcgcagtggcgcggtgatggtcgag
gcgctgtgggaggcgggcatcccccgggaactgctggtccttgtggacatcggggaagat
gagctcgggcagcagctcgtggccgacgcccgggtcgatcgggtcatcctcaccggatcg
tacgagacggccaagctgttccgttcctggcgtccggacctcccgctgctggctgagacg
agcgggaagaacgcgatcatcgtcacgccgagcgcggactacgacctcgccgtgtcggac
atcgtgaagagcgccttcgggcacgccgggcagaagtgctcggccgcgagcctcgtcatc
ctggtgggctcggtcgcgaagtccgagcggttccggaaccagctcgtggatgcggccacc
agcctgcgggtcggctatccgcaagacccaatgagtcagatgggtccgctgatcgaaccc
gcgagcggcaaactcctgcacgcgctcaccacgctcggtgcggacgaggactggctcgtt
cagccgaaacagctggacggcagcggcaggctgtggtcgcccggcatccggaccggcgtc
cagccggggtcgtacttccacctcaccgagttcttcgggccggtgctcgggatcatgacg
gccaggactctcgaggaggcggtgcgctatcagaacgcgatcgagtacgggctcacggcc
ggtctgcactcgctcgactccgaggaactcgcgcagtggctcgacaccgtcgaggcgggc
aacctgtacgtcaaccgcgggatcaccggggcgatcgtccggcgacagccgttcggcggg
tggaagcgttccgcggtcggtgcgggggcgaaagcgggagggccgaactacctgatcggg
ctcggaagctgtgaaccggacctcggccagtcgagttccagcctgcacctgcgcggcctg
gaacagcgggtgaccgacctgatcgaatcaggccagtcgtcgatgggctatcccgcgttc
gacctcgtgcgccggtccgccctgagcgatgcgatcgcgatggcgacggagtatcaccag
gtgagagatgtctccgggctcggagccgagagaaatctcttccgctacctcccggtcccg
gtgacgattcggctgtcggagggcgcgtccctgccggaactgcttcgcgtgatggcgtcc
gcgacggtggcgcgctcacggttctcggtcagcacgagcgtgaaactgccgagggggacc
gcccacctgctccgtgaacgcgaggtggaggtcgttgtcgagtccgacgcccactggctc
tcacgggtgcgtgcgcagcgcattccggaccatcgcatccggttgatcggcggcgacccg
gcggaactggctgcggcgctcggcggcatcccggatgtcgcggtctattccggcttggtc
acaccctcggggcgagtcgaggtgctgccgttcctgcacgagcaggccatctcgataacc
aaccaccggttcgggaatccgacgcggtcgacagaggaggcgatctga

DBGET integrated database retrieval system