KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx04650Help
Entry
Lxx04650          CDS       T00190                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00240  Pyrimidine metabolism
lxx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lxx04650 (deoA)
Enzymes [BR:lxx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Lxx04650 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AAT88454
UniProt: Q6AGP1
Position
463900..465216
Genome map
AA seq 438 aa AA seqDB search
MTQTAGTVEAFDAVDLIRTKRDRGELRTAEIDWLVDAYTRGYVGDEQMSAMAMAIFLNGM
TRREIKDLTLAMIASGERMDFSGLGKPTADKHSTGGVGDKITLPLMPLVAVFGVAVPQLS
GRGLGHTGGTLDKLESIPGWRADLSNEEMFAQLRNEGGVICAAGSGLAPADGKLYALRDI
TGTVEAIPLIASSIMSKKIAEGTGALVLDVKFGSGAFLKDIEKSRELARTMVELGTDAGV
ATSALLTDMNVPLGLAIGNANEVRESFEVLAGGGPADVVELTVALAREMLALAGQPDADV
EAALRDGRAMDKWREVIRAQGGDPEAALPVARETHTVLAAEDGVLIEQQALPFGIAAWRL
GAGRARRQDPLQHAAGIDLHAKPGDEIRAGQPLFTLSADEPARFERALEALDGAYRIAPA
GTPFERGPIVAERIGRAR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagaccgcaggaacggtcgaggcgttcgatgccgtcgacctgatcaggaccaag
cgcgaccgcggagagctccgcactgccgagatcgactggctggtggacgcctacacccgc
ggctacgtgggcgacgagcagatgtctgcgatggcgatggcgatcttcctcaacgggatg
acccgccgcgagatcaaggacctcacgctcgccatgatcgcctcgggcgagcgcatggac
ttctccggtcttggcaagcccaccgcggacaagcactccaccggcggtgtcggcgacaag
atcaccctgccgctcatgccgctggtcgccgtcttcggcgtcgccgttccgcagctctcc
ggccgcggtctcgggcacaccggagggacgctcgacaagcttgagagcatcccgggctgg
cgcgccgacttgtcgaacgaggagatgttcgcgcagctccggaacgagggcggcgtcatc
tgcgcggccggttcggggctcgccccggccgacggcaagctgtacgcgctgcgcgacatc
acgggtacggtcgaggccatcccgctgattgcctcctcgatcatgtccaagaagatcgcg
gagggcaccggcgcgctggtcctcgacgtgaagttcggttcgggagcgttcctcaaagac
atcgagaaatcgcgcgagctggcgcggacgatggtcgagctgggcacggacgccggggtc
gccacctcggcgctgctcacggatatgaatgtcccgctgggccttgcgatcggcaacgcc
aacgaggtgcgcgagtccttcgaggtgctcgccggcggcggtcccgccgatgtcgtggag
ctgacggtcgcactcgcgcgcgagatgctcgcactggccggtcagccggacgcggatgtc
gaggcggcgctgagggacgggagggcgatggacaagtggcgggaggtcatccgcgcccag
ggcggcgacccggaggcggcgcttccggtggcgagggagacgcacaccgtgctcgctgcg
gaggacggcgtcctgatcgagcagcaggccctccccttcggcatcgctgcgtggcgtctg
ggcgctggccgcgcccgcaggcaggacccgttgcagcacgcggcgggcatcgacctgcac
gcgaagccgggcgatgagatccgcgccggccagccgctgttcaccctctccgccgacgag
ccggcgcgcttcgagcgcgcgctcgaagcgctcgacggcgcctatcggatcgcccccgcc
gggacgccgttcgagcgcgggccgatcgtcgcggagcggatcggccgtgcccggtag

DBGET integrated database retrieval system