KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx11290Help
Entry
Lxx11290          CDS       T00190                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00260  Glycine, serine and threonine metabolism
lxx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01130  Biosynthesis of antibiotics
lxx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lxx11290 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lxx11290 (trpB)
Enzymes [BR:lxx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lxx11290 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: AAT88978
UniProt: Q6AF67
Position
1154263..1155474
Genome map
AA seq 403 aa AA seqDB search
MPLRSEEGPYFGDFGGRFVPESLVAALDELSAAWEAAKADPAFHVQLDELHRSYTGRPSI
VTEVPRFAEHGGGARLLLKREDLNHTGSHKINNVLGQAILTKRIGKTRVIAETGAGQHGV
AIATAAALFGLSCTIYMGEVDTERQALNVARMRLLGAEVVAVKTGSRTLKDAINDAMRDW
VTNVETTNYIFGTVAGPHPFPTMVRDLQRIIGEEAREQVLALTGRLPDAVAACVGGGSNA
MGIFHAFLDDENVRLVGFEAGGEGADTPRHAATITKGRPGVLHGARSLLLQDEDGQTIES
HSISAGLDYPGVGPEHAWLAAIGRAEYRPVSDAEAMEALRLLSRTEGIIPAIESAHALAG
ALDLGRELGPEGVVLVSLSGRGDKDMETAGRYFGLIEEGAVQS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcccctccgcagcgaagaaggtccctacttcggcgacttcggcggccggttcgttccg
gagtcgctggtcgccgccctcgatgagctgtcggcggcgtgggaggccgccaaggccgac
cccgccttccacgtccagctcgacgaattgcaccgctcctatacggggcgaccgtcgatc
gtcaccgaggtcccgcggttcgcggagcacgggggaggcgcccgtctcctcctcaagcgc
gaggacctcaaccacaccggctcgcacaagatcaacaatgtgctgggccaggccatcctg
accaaacgcatcggcaagacccgcgtcatcgcggagacgggcgcgggccagcacggtgtc
gccatcgcgacggcagcggcgctcttcggcctcagctgcacgatctacatgggcgaggtc
gacaccgagcgccaggcgctgaacgtcgcccgcatgcgcctgctcggggccgaagtcgtc
gcggtcaagaccggctcccgcaccctcaaggacgcgatcaacgacgcgatgcgcgactgg
gtgacgaacgtcgagacgaccaactacatcttcggcaccgtcgcgggaccgcaccccttc
ccgacgatggtccgcgatctgcagaggatcatcggcgaggaggcgcgcgaacaggtgctc
gcgctcaccggccggctgcccgatgcggtcgctgcctgcgtcggcggcggctcgaacgcg
atggggatcttccacgccttcctcgatgacgagaatgtgcgcctggtcggtttcgaagcc
ggcggcgagggcgcggatacgccgcgtcacgccgcgaccatcacgaagggacgccccggc
gtcctccacggcgcgcgcagtctgctcctgcaggatgaggacgggcagaccatcgagtcg
cactcgatctcggcagggctcgactatccgggcgtcggaccggagcacgcttggctcgcg
gcgatcgggcgggctgagtaccgcccggtgtccgacgctgaggcgatggaggcgctgcgc
ctcctcagccgcaccgagggcatcatcccggccatcgagtccgcgcacgccctcgccggg
gcgctcgaccttggccgcgagctgggaccggagggagtcgtcctggtcagcctctcgggc
cgcggcgacaaagacatggagactgccggacgctatttcggcctcatcgaagaaggggcc
gtgcagtcgtga

DBGET integrated database retrieval system