KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx21490Help
Entry
Lxx21490          CDS       T00190                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00790  Folate biosynthesis
lxx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lxx21490 (folE)
Enzymes [BR:lxx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Lxx21490 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AAT89842
UniProt: Q6ACQ1
Position
complement(2209836..2210411)
Genome map
AA seq 191 aa AA seqDB search
MTGFDRARIEAAVAEILAAVGEDPSRPGLSATPSRVADAYAEFFAGLGRDAEAELGEPVP
LEQGQAETVILREISFRSVCEHHLLPFIGVAHVAYLPGEAVIGLGRIPRVIDTLAARPQV
QERLTEQIADTFEAGAGARGVLVVLSAEHGCVTARGPRQVAATTVTLAARGEFAEPAARA
ELIALIGCGAA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtttcgatcgcgctcgcatcgaggcggccgtcgctgagatcctcgccgctgtc
ggcgaggatccgtcgcggccgggtctgagcgctacgccgtcccgagtggcggacgcctac
gcggagttcttcgcgggcctcggccgggacgccgaagcggagctcggcgagccggttcca
ctggagcaggggcaggctgagacggtcatcctgcgcgagatctcgttccgttcggtgtgt
gagcaccacctgctgccgttcatcggcgtcgcgcatgtcgcctacctgcccggagaggcc
gtgatcggcctcggccggatcccccgcgtcatcgacacgctcgccgcgcgtccccaggtc
caggagcggctgaccgagcagatcgccgacacattcgaggccggtgcgggcgcgcggggt
gtgcttgtcgtgctgagcgcggagcacggctgcgtcaccgcccgcggtccgcggcaggtc
gcggcgacgacggtgaccctcgccgcgcgcggcgagttcgcggagccggccgcgcgcgcg
gagctcatcgcgctgatcgggtgcggtgcggcgtga

DBGET integrated database retrieval system