KEGG   Leifsonia xyli subsp. xyli CTCB07: Lxx22610Help
Entry
Lxx22610          CDS       T00190                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lxx  Leifsonia xyli subsp. xyli CTCB07
Pathway
lxx00010  Glycolysis / Gluconeogenesis
lxx00071  Fatty acid degradation
lxx00350  Tyrosine metabolism
lxx00625  Chloroalkane and chloroalkene degradation
lxx00626  Naphthalene degradation
lxx01100  Metabolic pathways
lxx01110  Biosynthesis of secondary metabolites
lxx01120  Microbial metabolism in diverse environments
lxx01130  Biosynthesis of antibiotics
lxx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lxx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lxx22610 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Lxx22610 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lxx22610 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lxx22610 (adh)
   00626 Naphthalene degradation
    Lxx22610 (adh)
Enzymes [BR:lxx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lxx22610 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C PCMT TrkA_N Methyltransf_11 Methyltransf_25 2-Hacid_dh_C DUF3179 UPF0146
Motif
Other DBs
NCBI-ProteinID: AAT89928
UniProt: Q6ACG5
Position
2330595..2331647
Genome map
AA seq 350 aa AA seqDB search
MLIERKTPMRAAVVTSFTEPIVVEDVPLPTPGPGQVLVRIETCGLCHTDIHAAHGDWPVR
PSLPFIPGHEGVGRVTALGEGVTAPAVGTRVALAWLGSACGSCRYCETGRENLCVSQQNT
GYSIDGAYAEYAVADARFAVPVPDSVSSMDAAPLTCAGVTAYVAVKTARVRPAERVVVFG
VGGLGHLAVQYARLVGAEVIAVDVTDEKLALATELGADHVVNARTSDPVQEIHALGGADA
VIVLAVAPAVFDQAFRSLSRGGRLILVSLPANGVMGIPVFETVLNGITVAGSIVGTREDL
AEVFRLQALGRTRVIAQPRELEQAPEAMQEVLDGTVPARLVFDLAHVGSH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgctcatcgaaaggaaaactcccatgcgtgcagccgtcgtcacgtccttcaccgagccg
atcgtcgtggaggacgtccccctccccacgccgggacccggccaggtgctcgtgcgtatc
gagacctgcggtctctgccataccgacatccatgccgcccacggggactggccggtgcgc
ccctcgcttccgttcattcccggacacgaaggcgtcggccgcgtcactgccctcggcgag
ggtgtcaccgcgcccgccgtcggaacccgagtggcactcgcgtggctgggaagcgcgtgc
gggtcgtgccgctactgcgagaccggtcgcgagaacctctgtgtctctcagcagaacacc
ggctactccatcgacggggcgtacgcggaatatgcagtcgcggacgcgagattcgccgtg
cccgtacccgattcggtgtcgtcgatggatgccgcgcccctcacgtgcgccggggtcacc
gcatacgtcgccgtcaagacggcacgtgtgcggccggcggaacgggtggtcgtcttcggg
gtgggagggctcgggcatctcgcggtgcagtacgcgcgattggtgggagcggaggtcatc
gccgtagacgtgaccgacgagaagctcgcactcgccaccgagctcggagccgaccacgtc
gtcaacgcccgcacctcggaccccgtgcaggagatccacgccctcggcggtgccgatgcc
gtcatcgttctcgcagtcgcccccgccgtgttcgaccaggcgttccgctccctcagccgg
ggagggcgcctcatcttggtgtcgcttcccgcgaacggagtgatggggatccccgtcttc
gagaccgtgcttaacggcattaccgtggccggttcgatcgtcgggacgcgggaggacctc
gccgaagtcttccgccttcaagcgctcggccggacacgggtcatcgcgcagccccgagaa
ctggagcaagcccccgaagcgatgcaggaagtgctcgacggcaccgtgccggcacgtctg
gtgttcgatctggcgcacgtagggagccactga

DBGET integrated database retrieval system