KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_07290Help
Entry
O159_07290        CDS       T02852                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
lxy00450  Selenocompound metabolism
lxy00970  Aminoacyl-tRNA biosynthesis
lxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    O159_07290
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O159_07290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lxy01007]
    O159_07290
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lxy03016]
    O159_07290
Enzymes [BR:lxy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     O159_07290
Amino acid related enzymes [BR:lxy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   O159_07290
Transfer RNA biogenesis [BR:lxy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    O159_07290
 Prokaryotic type
   Other AARSs
    O159_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 17047808
NCBI-ProteinID: AGW40903
UniProt: U3PBP6
Position
complement(692443..694032)
Genome map
AA seq 529 aa AA seqDB search
MSDGSSFFITTPIFYVNDVPHIGHAYTEVAADVLARWHRQAGDDTWLLTGTDEHGQKILR
TATANGTTPKEWADRLVRDEWLPLLTTVDIVNDDFIRTTDERHEKNVQKFLQKLYDDGFI
YAGEYEALYCVGCEEFKPQSEIVDGTGEYAGQKVCAIHSKPLELLQEKNYFFRMSDFADR
LLALYEERPDFVQPESARNEVVSFVRQGLSDLSISRSSFDWGVKVPWDESHVVYVWFDAL
LNYITAIGYGQDEEAFERRWPATHLVGKDILRFHAVIWPAMLMAAGLDMPHRVFGHGWLL
VGGEKMSKSKLTGIAPTQITDTFGSDAFRYYFLRAITFGQDGLFSWEDLSVRYQAELANG
FGNLASRVVAMVTRYFGGEVPAAGEYREADLEVQRVVAQATADADAAMARLAVHDGIAAV
WTIVDQLNGYITEQEPWALAKDEAKRERLQTVLYTAVEGLRALAVLLSPVVPKATAKLWT
ALGVAGELGGLDAQRLRSAGDWGQVPAGTAVNGLEALFPRIEADAVLGA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacggctcttcgttcttcatcaccacgccgattttctacgtgaatgatgtcccg
cacatcgggcacgcctacaccgaggtcgccgccgacgtcttggcgcgctggcaccgtcag
gctggcgacgacacctggctgctgacgggcaccgatgagcacgggcagaagattctgcgc
accgcgaccgcgaacgggaccacgccgaaggaatgggccgaccggctggtcagggacgag
tggctgccgctgctgacgaccgtagacatcgtgaacgacgatttcatccgcaccacggac
gaacggcacgagaagaatgtgcagaagttcttgcagaagctctacgacgacggcttcatc
tacgccggcgagtacgaggcgctctactgcgtgggctgcgaggagttcaaaccgcagagc
gaaatcgtcgacggcacgggggagtacgcggggcagaaggtctgcgccatccactcgaag
ccgctggaactgctgcaggagaagaactacttctttcggatgagcgacttcgccgaccgg
ctgctggcgctctacgaggagcggccggacttcgtgcagccggagtcggcccgcaatgag
gtggtcagcttcgtgcggcagggactgtccgacctgtccatctcgcggtcgagcttcgat
tggggtgtcaaggtgccgtgggacgagtcccacgtcgtctatgtgtggttcgacgcgctg
ctcaactacatcacggcgatcggctacgggcaggacgaggaggcgttcgaacggcgctgg
ccggcgacgcacctagtcggcaaggacatcctgcgcttccacgccgtcatctggcccgcc
atgctgatggcggcgggcctggacatgccgcaccgggtgttcggccacggttggctgctg
gtgggcggcgagaagatgtccaaatcgaagctgaccggcatcgcgccgacccagatcacg
gacacattcgggtcggatgcgttccgctactacttcttgcgcgccatcaccttcggccag
gacggcttgttcagctgggaggacctgtccgtccgctatcaggccgagctggcgaacggt
ttcgggaacctcgcctcgcgggtcgtggcgatggtcacgcgctatttcggcggcgaggtc
ccggccgccggcgagtatcgggaggccgacctcgaggttcagcgcgtcgtcgcgcaggcc
accgctgacgccgatgccgcgatggcgcgcctcgccgtccacgatggcatcgccgccgtc
tggacgatcgtcgaccagctcaacgggtacatcaccgagcaggagccgtgggcgctcgcc
aaggacgaggcgaagcgcgagcggcttcagaccgtgctctacaccgcggtggagggcctg
cgcgcactcgccgtgctgctctcgccggtcgttccgaaggcgacggccaaactgtggact
gcgctgggcgtggcgggcgagctgggcggcctggacgcgcagcggctccgcagcgcaggc
gactgggggcaggtccccgccggaaccgcggtgaacggtctcgaggcgctgttcccccgc
atcgaggcggacgcggtgttgggagcatga

DBGET integrated database retrieval system