KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_08960Help
Entry
O159_08960        CDS       T02852                                 

Definition
(GenBank) two-component system sensor protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Brite
KEGG Orthology (KO) [BR:lxy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O159_08960
Enzymes [BR:lxy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     O159_08960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase HisKA PAS_9 PAS_4 PAS PAS_3
Motif
Other DBs
NCBI-GeneID: 17047938
NCBI-ProteinID: AGW41033
UniProt: U3PBZ6
Position
848469..851048
Genome map
AA seq 859 aa AA seqDB search
MTFERLLSRIPIDSPSPLMKQLPTLIGFALAVMLSFLPKVVTAVLPLYFFLAIGLIVLAT
VLAAMLPWNRMDTRWVVIVPIISMFAVGSLRLATDASVSPFVVLTLLPFVWIATEAGRIN
ILYAGAGTFLVLLAPLVVGDIPTNDGDIVRLVFSPFIYAIVALVVNEVAHRMRVHLAAAR
TAAVEQEATLARAVKAQDELVLNEARLKTANRLIQSVWNAVTEQSVIGSDLNGLIDVWNP
GAEKMLGLTEKQVIAGRRHVIEFHLASELENRLRDMDAQFITVPSVDDFSALIDAVRAGY
ADIRDWTYVRADGKHVPVQVAATPRLDENGHRVGFIFVATDMTQAREFARLKDEFVGLIS
HELRTPLSSILGYMELMRDDDEAPLSDKQLQYLSVAERNAHRLLRLVGDLLFTAQVESGH
FPHQLQGGRALGRHGGLGGVRRTGRGEREGGARQRSARASRRGSRRHGPSGAGCGQSRLE
RAQVHSGRWDGHRHPAGDGGGGDHRHRHRHRHPGRGAEQPLAALLPCVDGDTQRGSRGGP
RAHDHEGDRDGARRSSRHPERRGRRHLDQPAPARGEARAGGAGGSRGPGGHVSGAGVAVV
QFAPSDDRAHNRGTVAALLADAVERGARLVVFPEYSSYFADPLGVSFADNAEPLDGDFVR
SLADAARRHRVFAIAGLVERMGERHKFSNTLVAVDPSGATVAVYRKQHLYDAFGSRESER
AIPGDLAWPETFDVDGLRVGMQTCYDLRFPEVTRRLVDAGAQLVALPAQWVRGPRKEQHW
ATLLAARAIENTIYIAAAGHPPPSGVGASRIVDPVGVTIAGIAEETGVAVASVSAERLAA
VRERNPALGLRRYRVEPAG
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgaacgcttgctgagccggatacccatcgactccccttcgccgctgatgaag
cagctgccgacactcatcgggttcgccctggcggtcatgctgtccttcctccccaaagtg
gtcaccgcggtgctgccgctgtacttcttcctcgcgatcgggctcatcgtgctggcgacg
gttctcgctgcgatgctgccgtggaaccggatggacacccgctgggtggtcatcgtcccg
atcatctcgatgttcgcggtcggttcgctgcggcttgcgacagacgcttcggtgtcgccg
ttcgtcgtgctgacgctgctgccgttcgtctggatcgcgacggaagcgggccggatcaac
atcctgtacgccggagccggcactttcctggtgttgctggcgccgctggtggtcggtgat
atcccgacgaacgacggggacatcgtgcgcctcgtcttctccccgttcatctacgcgatc
gtggcactcgtcgtcaacgaagtggcgcaccggatgcgggtccatctggcggcggcgcgg
acggccgctgtcgagcaggaggccaccctcgcccgggcggtcaaggcgcaggacgagctg
gtgctcaacgaagcgcggctcaagacggccaatcggctcatccagagcgtctggaacgcc
gtcaccgagcaatctgtcatcggctcggatctcaacgggctcatcgatgtgtggaacccc
ggcgccgagaagatgctcggcctcaccgagaagcaggtcatcgcgggacgccgccacgtc
atcgagttccacctcgccagcgagctcgaaaaccggctgcgcgatatggacgcacagttc
ataacggtccccagcgtcgatgacttctcggccctcatcgacgcggtccgtgcgggctac
gccgatatccgcgactggacgtacgtgcgcgccgacggcaagcatgtgccggtgcaggtc
gcggccacgccacgcctggacgagaacggccaccgcgtcggcttcatcttcgtggcgacg
gatatgacgcaggcccgtgagttcgcgcggctgaaagacgagttcgtcggtctcatctcg
catgaattgcggacgccgctcagcagcatcctgggctatatggagctgatgcgcgacgac
gacgaggcgccgctgtcggacaagcagctgcaatacctgagcgtcgccgagcgcaacgcg
caccggctgctgcggctcgtgggggatctgttgttcacggcgcaggtcgagtccggccac
ttcccccatcagcttcaaggaggccgagctctcggccgtcatggcggcctcggtggagtc
cgccggaccggtcgcggcgaacgcgaaggtggagctcgtcagcgaagtgcccgagcatcc
cgtcgaggttctcggcgacacggtccgtctggggcaggctgtggacaatctcgtctcgaa
cgcgctcaagttcactccggccggtgggacggtcaccgtcaccctgcgggggacggagga
ggtggtgatcaccgtcaccgacaccggcatcggcatcccggccgtggagctgagcagcct
ctcgcagcgcttcttccgtgcgtcgacggcgacacgcaacgcggttccaggggtgggcct
cgggctcacgatcacgaaggtgatcgtgacggcgcacggcggtcgtctcgacatccagag
cgaagagggcgtcggcacctcgatcagcctgcacctgcccgcggggaagcccgcgccggc
ggagcaggtggctcccgaggtccaggcggccacgtgagcggtgccggggtcgccgtcgtc
cagttcgcccccagcgacgaccgcgctcacaaccggggaaccgtcgcggcgctgctcgcc
gacgcggtggaacgaggagcgcggctcgtcgtcttccccgagtactcctcgtacttcgca
gacccgctcggtgtctctttcgccgacaacgccgaaccgctcgatggcgatttcgtccgt
tcgctcgcggatgcggcccgtcggcacagggtgttcgccatcgccggcctggtcgagcgg
atgggggagcgtcacaagttctccaacacgctcgtcgccgtcgatccgtcgggggcgacg
gtggcagtgtaccgcaaacagcacctctacgacgcgttcggctctcgcgagtccgagcgg
gcgatcccgggagacctcgcctggccggagacgttcgacgtcgacggtctccgggtcggg
atgcagacctgctacgatctccgatttcccgaagtgacccgccgcctcgtggacgccgga
gcgcagctcgtcgcccttcccgcccagtgggtgcgcggtccgcgcaaagagcagcactgg
gccacgctgctcgccgcgcgcgccatcgagaacacgatctacatcgctgccgcgggccat
cccccgccgtccggtgtcggcgccagccggatcgtggacccggtgggtgtcacgatcgcg
ggcatcgccgaggagaccggtgtcgccgtcgcgagcgtctctgccgagcgcctcgcagcg
gtgcgcgagaggaaccctgcgctgggactgcggcgctaccgggtcgagcccgccggctag

DBGET integrated database retrieval system