KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_12910Help
Entry
O159_12910        CDS       T02852                                 

Definition
(GenBank) glucosyltransferase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
lxy00500  Starch and sucrose metabolism
lxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O159_12910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lxy01003]
    O159_12910
Enzymes [BR:lxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     O159_12910
Glycosyltransferases [BR:lxy01003]
 Polysaccharide
  Storage polysaccharide
   O159_12910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 17048273
NCBI-ProteinID: AGW41368
UniProt: U3PCY4
Position
1228338..1229519
Genome map
AA seq 393 aa AA seqDB search
MRVDLLTREYPPAVYGGAGVHVTELVRALRNGTEVFVRCFGEPREEPGTVAYRAPGELAG
ANGAIATLGVDLQMAQDCGGADIVHSHTWYANAGGHLAKLLHDVPHVVTAHSLEPLRPWK
AEQLGGGYAVSGWIEKTAFEAADTVIAVSDGMRRDILASYPALDPSKVTVVYNGIDLERW
RPLDDGERVRALGIDPGRPAVIFVGRITRQKGLPYLLRAARMLPEEVQLILCAGAPDTPE
ILAEVSGLVGRLQEERDGVVWIDRLLPNDQLRAALTASTVFVCPSVYEPLGIVNLEAMAC
GLPVVGTATGGIPEVIVDGVTGRLVPIDQMQDGSGTPLDPEAFVRNLAAALTEVVGDRER
AARMGAAGRVRAEAEFSWTAIAEQTRLVYRSLV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgatcttctcacccgtgagtacccgcctgctgtctacggtggcgcgggggtg
catgtgaccgaactcgttcgggctctccggaacgggaccgaggtgttcgtgcggtgcttc
ggagagccccgcgaggagcccggcaccgtcgcctaccgggcgccgggggaactcgccggc
gcgaatggggcgatcgccactctgggggtggatctgcagatggcgcaggactgcggcggc
gccgacatcgtccactcgcacacctggtacgccaacgcgggcggccacctggccaagctg
ctgcacgacgttccgcacgtcgtcaccgcgcacagcctggagccgctccgcccgtggaag
gctgagcagctcggcggcggctacgccgtctccggctggatcgagaagaccgcgttcgag
gcggccgacacggtcatcgccgtgagcgacgggatgcggcgcgacatcctcgcttcctac
ccagcgctcgatccgtcgaaggtgactgtcgtctacaacggcatcgacctcgaacgctgg
cgtccgctggacgacggcgagagggtacgggcgctcgggatcgaccccgggcgccccgca
gtgatcttcgtcggccgcatcacgcgccagaagggcctgccgtatctgctccgcgctgcg
aggatgctcccggaggaggtgcagctcatcctgtgcgccggcgccccggacacgccggag
atcctcgcggaggtgagcgggctcgtcgggcggctgcaggaggagcgggacggcgtggtc
tggatcgatcggctgctcccgaacgatcagctgcgagcggcgctcacagcgtccaccgtc
ttcgtctgcccgtcggtctacgagccgctcgggatcgtgaacctggaggcgatggcgtgc
ggcctcccggtcgtcgggaccgccacgggcggtatccccgaggtgatcgtggacggtgtc
accggcaggctggtgccgatcgaccaaatgcaggacggcagcggaacgccgctcgacccc
gaggcgttcgtccgcaatctcgccgcggcgctgacggaagtcgtcggcgaccgggagcgt
gcggcgcggatgggggcggccgggcgggtgcgggcggaggcggagttcagctggaccgcc
atcgcagagcagacccggctcgtctaccgctcgctggtctga

DBGET integrated database retrieval system