KEGG   Leifsonia xyli subsp. cynodontis DSM 46306: O159_23510Help
Entry
O159_23510        CDS       T02852                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lxy  Leifsonia xyli subsp. cynodontis DSM 46306
Pathway
lxy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lxy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    O159_23510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lxy03011]
    O159_23510
Ribosome [BR:lxy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    O159_23510
  Bacteria
    O159_23510
  Archaea
    O159_23510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 17049217
NCBI-ProteinID: AGW42312
UniProt: U3PC28
Position
complement(2192931..2193341)
Genome map
AA seq 136 aa AA seqDB search
MVESIARVRHIRVTPMKARRVVNLIRGKQAQEALAILRFAPQGASEPVYKLVASAIANAR
VKADQTNTYLDEQDLYVSRAFVDEGTTLKRFQPRAQGRAFRINKRTSHITVVLATPDEAE
VAQPAKKASTVKKASN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgtgtgcgacacatccgcgtcacccccatgaaggcccgtcgc
gtcgtcaacctgatccgcggcaagcaggcccaggaggccctggccatcctgaggttcgcc
ccgcagggcgcgagcgagccggtgtacaagctggtcgcgtcggccatcgccaatgcgcgc
gtcaaggccgaccagaccaacacctacctggatgagcaggacctctacgtgagccgtgcc
ttcgtggacgaagggaccaccctgaagcggttccagccgcgcgctcagggccgtgccttc
cgcatcaacaagcgcaccagccacatcaccgtcgtcctcgcgacgccggatgaggctgag
gtcgcccagccagctaagaaggccagcactgtgaagaaggcgagcaactaa

DBGET integrated database retrieval system