KEGG   Lysinibacillus sp. B2A1: C3943_02550Help
Entry
C3943_02550       CDS       T05347                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
lyb  Lysinibacillus sp. B2A1
Pathway
lyb00020  Citrate cycle (TCA cycle)
lyb00620  Pyruvate metabolism
lyb00650  Butanoate metabolism
lyb01100  Metabolic pathways
lyb01110  Biosynthesis of secondary metabolites
lyb01120  Microbial metabolism in diverse environments
lyb01130  Biosynthesis of antibiotics
lyb01200  Carbon metabolism
Module
lyb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lyb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3943_02550
   00620 Pyruvate metabolism
    C3943_02550
   00650 Butanoate metabolism
    C3943_02550
Enzymes [BR:lyb01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     C3943_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AVK82505
UniProt: A0A2S0JGT7
Position
522492..524018
Genome map
AA seq 508 aa AA seqDB search
MEEKLAKKLRNEQLRSKVVTAEEAASWIKDGMVLGMSGFTRAGDVKVVPLALVEKAKKES
FQVDVYTGASLGPEVDQYLAEAGVIRKRGPFQADAGIRNKINSGDITFVDAHLSHNAELV
RQSIIGPIDFAIIEAAAITEDGLLIPTTSVGNSPIFVQEADQVIIELNVAQLDALEGVHD
IFVPGPQGKRDPILLQKASDRLGTTGIPLDLEKVKGIVISDILDAPSTIVPADEETDIMA
NHLLSFLRDEIKVGRLTTSLRPIQSGVGSVANAVLLGFKESEFENLEVYSEVLQDAVFEL
IDAGKVSFASATSITLSEEVGNRVYGNFDKYADKLVLRPQEISNQPEIIRRLGLISVNTA
LEVDIYGNVNSTHVSGTKMMNGIGGSGDFARNARLGIFVTKSYAKGGNISSIVPMVSHVD
HTEHDVDVIVTEQGVADLRGLAPKERVALIIDNCAHPEYREQLWKYFNDANEATGGHHTP
HDLEKALSWHVNYAKSGTMKDAVLSKKK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagttagcgaaaaagcttcgtaatgaacagctgcgaagcaaggttgtcaca
gcagaagaagcagcatcttggattaaggatggtatggtacttgggatgagtggatttaca
cgtgctggtgatgttaaagtagtaccgcttgcacttgttgaaaaagctaaaaaagagagc
tttcaggtagatgtatatacaggtgcatcactaggtcctgaagttgaccagtacttagcc
gaggctggcgttattcgtaaacgtggacctttccaggcagatgcgggaattcgaaataaa
atcaacagtggtgatattacatttgtcgatgcgcatctgtcacacaatgcagaattagta
cgacagagcattataggtcctattgattttgcgattattgaagcggctgctattacagaa
gatggcttactaattcctacaacttctgttggtaattctccgatttttgtacaagaggcc
gatcaagtaattattgagctgaatgtggctcagcttgatgcattagagggagtgcatgat
atctttgttccaggaccacaaggaaaacgtgatccaattctattacaaaaggcttcagat
agacttggcacaacaggtattccgctagatttagagaaagtaaagggtattgtgatttct
gatattttagatgcgccatcaacaattgttccggctgatgaagaaacagatattatggcc
aatcatttattaagtttcctacgtgatgaaattaaagtgggacgtttaacaacgagttta
cgaccaattcagtcaggagtagggtccgtagcaaatgctgtattattaggcttcaaagag
tctgagtttgaaaatttagaggtctactcagaagtgctgcaggatgcagtattcgaatta
attgatgctggtaaagtaagttttgcatctgctacttctattaccctgtcagaggaagtt
ggaaaccgggtttatggtaattttgataaatatgcagataaattagtattacgcccacag
gaaatttcgaatcagccagaaattattcgccgactcgggttgatttctgtaaatacagcg
ctggaagttgatatttacggaaatgtgaattcaacacatgtttctggcacaaaaatgatg
aacggtattggtggttctggagactttgcacgtaacgcacgattgggtattttcgtcaca
aagtcttacgcaaaaggtggtaatatctcaagtattgttccaatggtatcacatgtggat
catacagagcacgatgtagacgtaatcgtgacagagcagggggtagcggacttgcgagga
ctggctccgaaagaaagagttgcgttaattatcgataattgtgcacatcctgagtatcgt
gagcaattatggaagtattttaacgatgctaatgaagcaacgggtggacatcatacgccg
cacgacctagagaaagcgctttcatggcatgtaaattatgcaaaaagcggcactatgaag
gacgcagtattatcaaaaaaaaaatag

DBGET integrated database retrieval system