KEGG   Lysinibacillus sp. B2A1: C3943_12620Help
Entry
C3943_12620       CDS       T05347                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lyb  Lysinibacillus sp. B2A1
Pathway
lyb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C3943_12620
Enzymes [BR:lyb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C3943_12620
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C3943_12620
    1.1.1.-  
     C3943_12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 ADH_N_assoc Shikimate_DH Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AVK84350
UniProt: A0A2S0JLR0
Position
complement(2685377..2686432)
Genome map
AA seq 351 aa AA seqDB search
MKAARWYKAKDIRVENIEEPVIAPGKVKIKVHWTGICGSDLHEYAAGPIFIPVEQPHYVS
KDIAPIVMGHEFSGEVVEIGEGVSKVQVGDPVVVEPILACGECAACKKGKYNICKHLGFH
GLSGGGGGFSEFTMVDEKMVHKMPEGLSYEQGALVEPAAVALHAVRQSKLKAGDKAAVFG
AGPIGLLVIEALRAAGASEIYAVELSAERAAKALELGATAVINPKDEDVVARLHELTNGG
VDVAFEVTGVPVVLQQAIDSTSFEGETIIVSIWETAASILPNNIVLSERTVKGIIAYRDI
FPAVMELMTQGYFPAEKLVTKRIALDEVVTEGFEALMKEKNHIKILVNSQA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaagatggtataaagcgaaagacatccgtgtagaaaacattgaagaacca
gttattgcacctggaaaagtgaaaattaaagtacattggacaggaatttgtggcagtgat
ttacatgaatatgcagctggccctatattcatcccagtggaacaacctcactatgtaagt
aaagatattgcaccaatcgtgatgggacatgagttctcaggtgaagttgtagaaatcggt
gaaggcgtttccaaagtacaggtaggagatcctgttgttgttgagcctattcttgcatgt
ggcgaatgtgctgcttgtaaaaaaggtaaatacaatatttgtaagcacttaggtttccac
ggtctttctggcggtggcggtggcttctctgaatttacgatggtagacgaaaaaatggta
cacaaaatgccagagggactttcctatgaacaaggtgcacttgtagagcctgcagcggta
gccctacatgctgtacgtcaaagtaagctaaaggctggcgataaagcggctgtctttggc
gcaggaccaattggattattagtgattgaggcattacgtgcagctggagcatctgaaatt
tatgcagtagagctttcagcagagcgtgcagcaaaagcgttagaattaggcgcaacagct
gttattaatccaaaggatgaggatgtagttgctcgactacatgaattaacaaacggtggc
gttgatgttgcatttgaagttactggtgttcctgtagtgttacagcaagccattgattca
acatcctttgaaggtgaaacaattattgtttcaatttgggaaacagcagcttctatactg
ccaaacaatattgttctttcagagcgtactgtaaaagggattattgcataccgtgatatt
ttcccggcagttatggaattaatgacacaaggttacttccctgctgagaagctcgtaaca
aaacgtattgcattagatgaagtagtgacagaaggctttgaggctttaatgaaagagaaa
aaccatattaaaattctagtaaattctcaagcttaa

DBGET integrated database retrieval system