KEGG   Lysinibacillus sp. B2A1: C3943_24950Help
Entry
C3943_24950       CDS       T05347                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lyb  Lysinibacillus sp. B2A1
Pathway
lyb00450  Selenocompound metabolism
lyb00970  Aminoacyl-tRNA biosynthesis
lyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lyb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C3943_24950
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C3943_24950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lyb01007]
    C3943_24950
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lyb03016]
    C3943_24950
Enzymes [BR:lyb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C3943_24950
Amino acid related enzymes [BR:lyb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C3943_24950
Transfer RNA biogenesis [BR:lyb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C3943_24950
 Prokaryotic type
   Other AARSs
    C3943_24950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DZR DUF4677 Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AVK86495
UniProt: A0A2S0JT93
Position
complement(5101927..5103561)
Genome map
AA seq 544 aa AA seqDB search
MTIVIGGAWPYANGSLHLGHVAALLPGDILARYYRQKGERVLYVSGSDCNGTPISIRAAQ
ENTTTEAIANHYHEEFTRCFTDLGFTYDLYTRTDAKHHHDSVKAIFLQLLANNFLYKKKI
EQAYCETDKQFLPDRFVEGVCPNCGAKARGDQCDHCSTILDPLDLNDKRCKICGNEPIIR
ETEHFYFAFSQFQGRLDTYLAEAKAEKRWRDNALGLTERYLAEGVPDRAVTRDLPNGIDV
PVPGFEGKKIYVWIEAVAGYLTASIEWAKQHQIAIEDLWNEETISYYVHGKDNIPFHTVI
WPAILMGIGAKALPTHIVSNEYLTLEKRKLSTSQNWAVWVPYILSRYDADSIRYFLTMNA
PENRDTDFSWREFIYSHNGELLGAYGNFVNRTLKFIEKSFEGQVPQAEVDGNVRKQTIQL
FNEVSNLIEAGHFKQALEAIFEYIRAANRYFDEQQPWLQVKENVEAGNQTLATCVYIIAN
LGQLLHPFLPFSAEKVRRMLGIRELMWHEQVELPAFINEVTPLFERLDVELIEEEFQKLV
KDSQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgttattggaggcgcttggccatatgcaaatggttctttgcatttaggacat
gttgctgcactattaccaggtgatattttggctagatattaccgtcaaaagggcgaaagg
gttttatatgtgtcagggagtgattgtaatggcacaccgatttctattcgcgctgcacag
gagaacacaactactgaggctatcgctaatcattatcatgaggaatttacacgatgcttt
actgatttaggatttacctatgatttgtatacccgtacagatgctaagcatcatcatgac
tctgtaaaggccatttttttacagctacttgcaaataactttttatataaaaagaaaatt
gagcaggcttattgtgaaacagacaaacagttcttgccagatcggtttgtagagggagtt
tgtccaaactgtggtgcaaaggcacgtggtgatcagtgcgatcactgttccacaatttta
gatccactcgatttaaacgataaacgttgtaaaatttgtggcaatgagccaattattaga
gaaacggagcatttttattttgcctttagtcaatttcaaggaagattggacacatattta
gcagaggcaaaggctgaaaaacgctggcgtgataatgcccttgggctaacagagcgttac
ttggctgaaggagttccagaccgtgcagtgacgagagatttaccaaatggtattgatgtt
ccagttccgggatttgaaggtaaaaaaatatatgtatggattgaagcggttgcaggttat
ttaactgcaagcatcgaatgggcaaagcagcatcaaatagctattgaggatttatggaat
gaagaaacaatctcgtattatgtacatggtaaggataatatcccattccataccgttatt
tggccagccattctaatgggaataggggcaaaggcattaccaacacatattgtgtcgaat
gaatatttgacgctagaaaaacgaaaattatcaaccagtcaaaattgggcggtatgggtg
ccatatattttaagtcgatatgatgcggattcgattcgttactttttaacaatgaatgcc
ccagaaaaccgtgatacggatttctcctggcgggaatttatttatagccataatggggag
ttgcttggtgcatatggcaactttgttaatcgtacgttgaagtttattgaaaaatctttt
gaagggcaggtaccacaagctgaggtagatggaaacgttcgaaagcaaacgattcaattg
tttaatgaggtgagcaaccttattgaagcgggtcatttcaaacaagcattagaggctatt
ttcgaatatattcgggcagccaatcgttatttcgacgaacagcagccatggcttcaggtg
aaggagaatgtagaagcaggaaatcaaacacttgcaacatgtgtctatattattgcgaat
ctgggtcagctactacatccgtttttaccattttcagccgaaaaggtaagaagaatgtta
ggtatacgtgagctaatgtggcacgagcaggtagagcttccagcattcattaatgaggtg
acaccactgtttgaacgtcttgatgtggagctgatagaagaagaatttcaaaagcttgtg
aaggacagtcaataa

DBGET integrated database retrieval system