KEGG   Lysinibacillus sp. B2A1: C3943_25825Help
Entry
C3943_25825       CDS       T05347                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lyb  Lysinibacillus sp. B2A1
Pathway
lyb00220  Arginine biosynthesis
lyb00330  Arginine and proline metabolism
lyb01100  Metabolic pathways
lyb01110  Biosynthesis of secondary metabolites
lyb01130  Biosynthesis of antibiotics
lyb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lyb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C3943_25825 (rocF)
   00330 Arginine and proline metabolism
    C3943_25825 (rocF)
Enzymes [BR:lyb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     C3943_25825 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AVK86647
UniProt: A0A2S0JT90
Position
complement(5266946..5267851)
Genome map
AA seq 301 aa AA seqDB search
MNKLNISIIGVPTDYGQARRGVDMGPSAIRYAGVVERLEAIGHKVQDLGDIRVSQTLKNA
IVDEKLLNLEEVIDVSTALANNVHEVLEQKKFPLVFGGDHSIAIGTLAGLGEHYKNLGVI
WYDAHADLNTPETTPSGNIHGMPLAVSIGLGHDRLVRIRDFAPKIKPENVIIIGARSVDS
GERELIRQQGIKVYTMHEIDRLGMTRVMEDALSYLKERNVDGLHLSLDLDGLDPLYTPGV
GTPVPGGITYRESHLAMEMLQESGMLTSAEFVEVNPILDEKNTTANVAVALMGSLFGETL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttaatatttctattattggagttccaactgattatgggcaagcacgtaga
ggcgtagacatggggccaagtgcgatccgttacgcaggagttgtggaacgcttagaggcg
attggtcataaggtacaggatctaggggatatccgtgttagtcaaacacttaaaaatgct
attgtagatgagaaactactcaatttagaggaagtaattgatgttagtacagctttagca
aataatgtacacgaagtattagagcagaaaaagttcccgctagtatttggtggagatcat
agtattgctattgggacactagctgggcttggagagcattacaaaaacctaggtgttatt
tggtatgatgcacatgctgatttaaatacacctgagacaacaccttctggcaatatacat
ggtatgcctttggctgtaagcatcggacttggtcatgatcgcttagtcagaattcgtgac
tttgcgccaaaaattaaacctgagaatgttatcattattggagcacgatctgtagactca
ggtgaacgtgaacttattcgtcaacaaggcattaaggtatatacaatgcatgaaattgat
cgccttggtatgacgcgtgtaatggaagatgctcttagctatttaaaagaacgaaatgtt
gatggcttgcacttatcacttgatttagatggtctggatccactttatacgccaggagta
gggacacctgttccagggggaattacgtatcgtgaaagtcatttagctatggaaatgtta
caagaatcgggtatgttgacatctgctgaatttgttgaagtaaatccgattttagatgaa
aaaaatacaacggctaatgttgctgttgcattaatgggttctttattcggagaaacacta
gtttaa

DBGET integrated database retrieval system