KEGG   Protaetiibacter intestinalis: D7I47_02685Help
Entry
D7I47_02685       CDS       T05661                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lyd  Protaetiibacter intestinalis
Pathway
lyd00450  Selenocompound metabolism
lyd00970  Aminoacyl-tRNA biosynthesis
lyd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lyd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D7I47_02685
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D7I47_02685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lyd01007]
    D7I47_02685
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lyd03016]
    D7I47_02685
Enzymes [BR:lyd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D7I47_02685
Amino acid related enzymes [BR:lyd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D7I47_02685
Transfer RNA biogenesis [BR:lyd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D7I47_02685
 Prokaryotic type
   Other AARSs
    D7I47_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AYF97262
UniProt: A0A387B177
Position
complement(549127..550725)
Genome map
AA seq 532 aa AA seqDB search
MPSGESFFITTPIFYVNDVPHIGHAYTEVAADVLARWHRQAGDDTWLLTGTDEHGQKILR
TAAANGVEPKQWADQLVESAWKPLLETIDIANDDFIRTTDRRHEDAVAVFLQKLYDDGFI
YAGEYEGYYCVGCEEYKQLDDLETATEGEYAGQLVCRIHSRPVEILREKNYFFKMSQFED
ALLDLYETQPDFIQPESVRNEIVQFVRQGLADLSISRSSFDWGIKVPWDPSHVVYVWFDA
LLNYVTAVGYGTDEAEFARRWPAYHLVGKDIARFHAVIWPAMLMAAGLPVPHKVFGHGWL
LVGGEKMSKSKLTGIAPNQITDTFGSDAFRYYFLRAITFGQDGSFSWEDLSARYQAELAN
GFGNLASRVVAMVARYRGGVLPAPGEYADADLDIQNTTARAVAAADAAIESFAINEAIAS
VWTVVDALNGYITEQEPWVLAKDEAQASRLDTVLYTASEGLRALAVLLSPVLPKATEKLW
AALGAEPTLGALTAQPLREAGTWGQLPAGSTVSALEALFPRIEEPGADAGAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgccatccggcgagagcttcttcatcacgacgcccatcttctacgtcaacgacgtgccc
cacatcggccacgcgtacacggaggtggcggccgacgtgctcgcccgctggcaccgtcag
gcgggcgacgacacctggctgctcaccggcaccgacgagcacggccagaagatcctgcgc
accgccgccgcgaacggcgtcgagccgaagcagtgggccgaccagctcgtcgagtcggcg
tggaagccgctgctcgagacgatcgacatcgccaacgacgacttcatccgcaccaccgac
aggcgccacgaggatgccgtggccgtcttcctgcagaagctgtacgacgacggattcatc
tacgcgggcgagtacgagggctactactgcgtcggctgcgaggagtacaagcagctcgac
gacctcgagacggcgaccgagggcgagtacgccggccagctcgtgtgccgcatccactcg
cgcccggtcgagatcctgcgcgagaagaactacttcttcaagatgagccagttcgaggat
gcgctgctcgacctctacgagacgcagcccgacttcatccagccggagagcgtgcgcaac
gagatcgtgcagttcgtgcggcaggggctcgccgacctgtcgatctcgcggtcgagcttc
gactggggcatcaaggtgccgtgggatccgagccacgtcgtctacgtgtggttcgacgcg
ctgctgaactacgtcaccgcggtcggctacggcaccgacgaggccgagttcgcgcgtcgc
tggcccgcctaccacctggtcggcaaggacatcgcccgcttccacgccgtcatctggccc
gccatgctcatggcggccgggctgcccgtgccgcacaaggtgttcggccacggctggctg
ctggtcggcggcgagaagatgtcgaagtcgaagctcaccggcatcgccccgaaccagatc
accgacaccttcgggtcggacgcgttccgctactacttcctgcgcgccatcaccttcggg
caggacggctcgttcagctgggaggacctctccgcccgctaccaggccgagctcgccaac
ggtttcggaaacctcgcctcccgcgtcgtcgcgatggtcgcccgctaccgcggcggcgtg
ctgccggcgccgggggagtacgcggatgccgacctcgacatccagaacacgaccgcgcgg
gcggtcgcggcggcggatgcggcgatcgagtcgttcgcgatcaacgaggcgatcgcatcc
gtgtggacggtcgtcgacgcgctgaacggctacatcaccgagcaggagccgtgggtgctc
gccaaggacgaggcgcaggcgtcgcggctcgacaccgtgctgtacacggcgagcgagggc
ctgcgtgcgctcgcggtgctgctgagccccgtgctcccgaaggcgaccgagaagctgtgg
gccgccctcggggcggagccgaccctcggtgcgctgacggcgcagccgctgcgcgaggcg
ggcacctgggggcagctgccggccgggtcgaccgtgtcggccctcgaggcgctgttcccg
cgcatcgaggagccgggcgccgacgcgggagccgcgtga

DBGET integrated database retrieval system