KEGG   Lysinimonas sp. 2DFWR-13: D7I47_06145Help
Entry
D7I47_06145       CDS       T05661                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lyd  Lysinimonas sp. 2DFWR-13
Pathway
lyd00900  Terpenoid backbone biosynthesis
lyd01110  Biosynthesis of secondary metabolites
lyd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lyd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D7I47_06145
Enzymes [BR:lyd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     D7I47_06145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AYF97881
UniProt: A0A387B7V5
Position
1277082..1278410
Genome map
AA seq 442 aa AA seqDB search
MRSVAGTRLDRRPIRGGAPVSINSRLSGLRDLDATARRAAVTEAAGLDAGALDALDPARG
LTLEAADHLIENVVGIIGIPVGVATNFTIDGVDRLVPMATEEPSVVAAASNAARMTRGHG
GFRTSTTGPVMIAQIQVVDAADPEAARLRLLEAREELLALADAQDPMLTSLGGGARDLVV
RTLPTRTGVHLVAHLHVDVRDAMGANAVNTMAEALAPRVAELADGRSLLRILSNKADQRL
IRARAVFDAELLGGAQVVRDIVHASAFAEADPYRAATHNKGIMNGITAVVLATGNDTRAV
ESGAHSHAARGGGYTALSHFELGEGGHLAGTLELPLAVGLVGGATRAHPVAQAAIRLLGI
RTAAELAAVIASVGLAQNLAALRALAAEGIQRGHMTLHARTIAASAGAAGEEITRVAERI
VADKLIRLEHAQDVLAELRSVR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcggtcgcggggacgcggctcgatcgacgaccgatccgtggaggagcaccagtg
tcgatcaacagccgactgtcgggactgcgggatctcgacgccaccgcacggcgtgccgcg
gtgaccgaggccgccggcctcgacgcgggcgccctcgacgccctcgaccccgcgcgcggc
ctcacgctggaggccgccgaccacctcatcgagaacgtcgtggggatcatcggcatcccg
gtcggcgtcgccaccaacttcacgatcgacggcgtcgaccgcctcgtgccgatggccacc
gaggagccgagcgtcgtcgctgcggcctcgaacgccgcccggatgacgcgcggccacggc
ggcttccgcacctccacgacgggccccgtgatgatcgcccagatccaggtggtcgacgcg
gcggaccccgaggcggcgcgcctgcgactgctcgaggcgcgcgaggagctgctcgcactc
gccgacgcgcaggacccgatgctcacgagcctcggcggcggcgcccgcgacctcgtcgtg
cgcaccctgcccacccgcacgggcgtgcacctcgtcgcccacctgcacgtcgacgtgcgg
gatgccatgggcgcgaacgcggtcaacacgatggccgaggcgctcgccccgcgcgtcgcc
gagctcgccgacggtcgctcgctgctgcgcatcctctccaacaaggccgaccagcggctc
atccgggcgcgggccgtgttcgacgccgagctgctcggcggcgcgcaggtggtgcgcgac
atcgtgcacgcgagcgccttcgccgaggccgacccgtaccgcgccgcgacccacaacaag
ggcatcatgaacggcatcacggccgtcgtgctcgcgaccggcaacgacacccgcgccgtc
gagtcgggtgcccactcgcacgccgcgcgcgggggcggctacaccgcgctgtcgcacttc
gagctcggcgagggcgggcacctcgcgggcacgctcgagctgccgctcgcggtcgggctc
gtcggcggcgcgacgcgcgcgcacccggtggcgcaggccgccatccgcctgctcggcatc
cgcacggcggccgagctggccgcggtcatcgcctcggtgggtctcgcccagaacctcgcg
gcgctgcgggcgctcgcggccgagggcatccagcgcggccacatgaccctgcacgcccgc
acgatcgccgcctccgcgggcgccgccggcgaggagatcacgcgcgtcgcggagcgcatc
gtggccgacaagctcatccggctcgaacacgcccaggacgtgctcgccgagctgcgttcc
gtgcgatga

DBGET integrated database retrieval system