KEGG   Lysinibacillus sp. SGAir0095: C1N55_05080Help
Entry
C1N55_05080       CDS       T06028                                 

Definition
(GenBank) glutathione-dependent formaldehyde dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
lyg  Lysinibacillus sp. SGAir0095
Pathway
lyg00010  Glycolysis / Gluconeogenesis
lyg00071  Fatty acid degradation
lyg00350  Tyrosine metabolism
lyg00625  Chloroalkane and chloroalkene degradation
lyg00626  Naphthalene degradation
lyg00680  Methane metabolism
lyg01100  Metabolic pathways
lyg01110  Biosynthesis of secondary metabolites
lyg01120  Microbial metabolism in diverse environments
lyg01130  Biosynthesis of antibiotics
lyg01200  Carbon metabolism
lyg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1N55_05080
  09102 Energy metabolism
   00680 Methane metabolism
    C1N55_05080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C1N55_05080
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    C1N55_05080
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C1N55_05080
   00626 Naphthalene degradation
    C1N55_05080
Enzymes [BR:lyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     C1N55_05080
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     C1N55_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C FtsJ GTP_EFTU_D2 ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: QCR31579
UniProt: A0A4P8S6V8
Position
1025130..1026269
Genome map
AA seq 379 aa AA seqDB search
MKAVTFQGTKDMQVKEVADPKIEKSDDIIIRVTSTAICGSDLHIYQGALPASKDYVIGHE
PMGIVEEVGPTVEKVKKGDRVVLPFNISCGHCHYCQHDMESQCDNSNPNPHVDTGGYFGF
TERYGGYQGGQAELLRVPYGNFVPFVIPKSVELEDESLLFMSDVLPTAYWSVESGGVKKG
DTVVVLGCGPIGLMTQKFAWMKGAKRVIAVDNLPYRLNHAKKMNNVEIINFDDHEDTGEY
IAEITKGGADVVIDCVGMDGKKNPLEVVEQKLKLSGGTTSAIRIGMKAIKKFGTLQITGV
YGSIYNHFPLGNLFERNITVKMGQAPVIHYMPMLFEMIKKGEIDPTEIITHKLPLNRASE
AYKTFNDHEDECIKVILKP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttactttccagggtactaaggatatgcaggtaaaagaggtagccgatcca
aaaattgaaaaaagtgacgatattattattcgtgtgacgtctacagccatatgtggctct
gatcttcacatctatcaaggtgcacttcctgcatcaaaagattatgtaattggtcatgaa
ccaatgggaattgttgaagaagttggccctactgtagagaaagtgaaaaaaggagatcgt
gtagtacttccatttaatatttcttgtggtcactgccattattgccaacatgatatggaa
agtcaatgtgacaactccaatccaaatccacatgtcgatacaggtggatattttggattt
actgaacgttatggaggttatcaaggtggacaagccgaattactacgtgtaccatatgga
aactttgtaccctttgttatcccgaaatctgtagaactagaagatgagtcgttactcttt
atgtcggatgttctcccaacagcatactggagtgttgaaagtggaggggtaaaaaagggg
gatacagtggtagtattagggtgtggtccaatcggtttaatgacccaaaaatttgcatgg
atgaaaggggcaaaacgtgtcattgcagttgataatcttccttatcgcttaaatcatgca
aaaaagatgaataatgttgaaattattaacttcgatgatcacgaagatacaggtgaatat
attgctgaaatcacaaaaggcggtgcagatgtcgtaatcgattgcgtagggatggatggg
aaaaagaatccgcttgaagtagttgagcaaaaattaaaactttcaggtggtacaactagt
gcaattcgtattggcatgaaagcaattaaaaagtttggaactttacaaattacgggtgtt
tatggctcaatctacaatcatttcccattaggtaatctgtttgaacgaaatataacggtt
aaaatggggcaagctcctgtaattcactacatgccaatgttattcgaaatgattaaaaaa
ggtgagattgatccaactgaaattatcacgcataaacttccgcttaatcgtgctagtgaa
gcatataaaacctttaatgaccacgaagatgagtgtattaaagtcatattaaagccctaa

DBGET integrated database retrieval system