KEGG   Lysinibacillus sp. SGAir0095: C1N55_08345Help
Entry
C1N55_08345       CDS       T06028                                 

Definition
(GenBank) quinonprotein alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
lyg  Lysinibacillus sp. SGAir0095
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1N55_08345
Enzymes [BR:lyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     C1N55_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: QCR32180
UniProt: A0A4P8S6W7
Position
1689202..1691415
Genome map
AA seq 737 aa AA seqDB search
MKISFSKVLVFSFVGIIIIAGLAFYAGVLTKKSLEDSYADEEGTGFVIKTPIEDQAENNG
KSPSQPQIKVDYAKEEWITHGGDYYNRRFSELDQVNLETIKDLQPEWVTSLGSSLDMKFS
GEATPIVVDGVMYIATAENDILALDAKTGEKVWEYRPEIEQKLDTVCCGWTTRGVAVADG
KVFAGLLDARLIALDQKTGELLWETEVADWEEGYTITSAPLFYNGKVYTGVAGGEYGIRG
RIMAYDAEYGHEVWRWYSIPAPYEENGDTWPDDENKNWLHGGAPIWNTPAVDPELGYIYF
VTGNTSPDLDGSKREGDNLYANSILALNAETGEYVWHFQQVHHDIWDLDPTNPVILFDVE
INGETRKALGEAGKTGWIYFLDRTNGEPLIGIEEKEVPQLAEQKTSPTQPFPIGDSFVPQ
EVTEEDVERDLSEDFEGEIGSIFTPFWEEPITLKPSAFGGANWPPSAYSPETEYFYVIGT
DGYIALSRMDEDIYEEGSMYIGSIMVPVSDAPTRGTITAMDVKTNTIAWQVVWDANAYSG
VLATAGDLIFVGHNDGRLIAFNAKTGEEVWSYKTDAGANAPSVTYEINGEQYLSIFAAGN
SLAGSVHGDKVYTFKLNGSWDGTPIDASESSSVEAGEEVVTTEEPAESDTTGDTSDPYEV
GLSIYEGNCLSCHGSMGENGHNGPNLQLSKLAENQEDVIERIKNGGSTMPAFGQILTEEE
IEEVARYVNEVLSKADE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagtttttccaaggtgctggtgttcagttttgtggggataattattattgct
ggtcttgctttttatgcgggagtcctaacaaaaaagagtttggaagatagctatgccgat
gaagaggggacaggatttgtcataaagacacctattgaagatcaagcggaaaacaatgga
aaaagccctagtcagcctcaaatcaaagtagactatgcaaaagaagaatggataacacat
ggtggagattactacaatcgtcgattctctgagcttgatcaagttaaccttgagacgatt
aaagatctgcaaccagagtgggttacaagcttaggttctagtttagatatgaagttttct
ggagaagcaaccccaattgtagtggatggtgtgatgtatattgcaacagctgaaaatgat
attttagcgttagatgcaaaaacgggagaaaaagtatgggaataccggccagagattgaa
caaaagctggatacagtttgttgtggttggactacaagaggagtagctgtagctgatggg
aaagtgtttgctggcctattagacgctagattaatagcattagatcaaaaaacaggagag
ttactttgggaaacagaagtcgctgattgggaagaaggctatacgattactagtgctcct
cttttttataatgggaaagtatacacgggtgtagctggaggagagtatggaattcggggt
agaattatggcctatgatgctgaatacggtcatgaggtatggcgatggtattcaattcct
gcaccatacgaagaaaatggagatacttggccagatgatgaaaataaaaattggctacat
ggtggtgccccaatttggaacacacctgcagtggacccagagctaggatatatttacttt
gtaacgggcaatacttctcctgatttagatggaagtaagagggaaggggataacctatat
gccaattccattcttgcattaaatgctgaaaccggcgagtatgtttggcatttccaacaa
gttcatcacgatatatgggacttggatccgacaaatccagtaatattatttgatgtggaa
atcaacggtgaaacaagaaaagctcttggagaagctggtaagacgggctggatctatttc
ttggatcgaacaaacggagaaccgttaatcggcatcgaagaaaaagaggtgccacagctc
gcagaacaaaagacctcaccaacacagccatttcctattggtgattcctttgtgcctcaa
gaagtgacagaagaagatgtagaacgagatttaagtgaagattttgaaggagaaatcgga
tccattttcactccattctgggaagagccaattactttaaaaccatctgcattcggtgga
gcaaactggccgccatcagcttactcaccagaaacagagtacttttatgttataggaaca
gatggttatattgcgttatcacgtatggatgaggatatttatgaagaaggttctatgtat
ataggtagtattatggttccggtttcggatgcaccaactagaggtacaattactgctatg
gatgtaaaaactaacacaattgcatggcaagttgtttgggatgctaatgcatattcaggt
gttctagcaacagctggtgacttaatatttgttggtcataacgatggtcgactcattgca
tttaatgcaaaaactggtgaagaagtttggagctataaaactgatgcaggggcaaatgct
ccttccgtaacgtatgaaattaatggggaacaatatctttcaatttttgctgcaggtaac
tctttagcaggttcggttcatggagataaagtgtacacgtttaaacttaatggcagctgg
gatggaacaccaattgatgcttcagaaagtagtagtgttgaagccggtgaggaagtcgta
actactgaagaaccagcagaatcggatacaactggggatacaagtgacccatatgaagtt
gggctttccatttatgaggggaactgcttatcctgtcacggcagtatgggtgaaaatggc
cataatggaccgaatcttcaactaagtaagcttgctgaaaaccaagaagatgttattgaa
agaataaaaaatggcggttccacaatgccagcctttggtcaaatattaactgaagaggaa
atcgaggaagttgcacgttacgtgaatgaagttttatcgaaagcagatgaatga

DBGET integrated database retrieval system