KEGG   Lysinibacillus sp. SGAir0095: C1N55_12040Help
Entry
C1N55_12040       CDS       T06028                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lyg  Lysinibacillus sp. SGAir0095
Pathway
lyg00480  Glutathione metabolism
lyg00590  Arachidonic acid metabolism
lyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C1N55_12040
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C1N55_12040
Enzymes [BR:lyg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C1N55_12040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: QCR32860
UniProt: A0A4P8S8J4
Position
2441025..2441495
Genome map
AA seq 156 aa AA seqDB search
MNIYDFDVRDENGEPYSLKKFEGKVLLIVNTATKCGLAGQFNELEELYKKYHDQGFEILG
FPSDQFKQELSTGNEAAEACRLTYGVSFPMHELVKVNGENAHPLFKHLTEETKGILGKNV
KWNFTKFLVDRDGNVVKRFAPTDKPSKFETEIAKYL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttatgactttgatgtaagagatgaaaatggggaaccgtattcactaaaaaaa
ttcgaaggtaaggtcctactcattgtaaacaccgcaacaaaatgcggattagctggccaa
tttaacgagttggaggaactttataagaagtatcatgatcaaggttttgaaatacttggc
ttcccttctgatcaattcaaacaagaattaagtacgggaaatgaagcagctgaagcttgt
cgacttacatatggtgtttctttcccaatgcacgaactcgttaaagtaaatggtgagaat
gcacatcccctcttcaaacatctaacggaagaaacaaaaggaattttaggtaaaaatgta
aaatggaattttaccaaatttttagttgatcgtgatggtaatgtcgtaaaacgctttgcc
ccaacagacaaaccttcaaaatttgaaacagaaatcgcaaaatatttataa

DBGET integrated database retrieval system