KEGG   Lysinibacillus sp. SGAir0095: C1N55_15225Help
Entry
C1N55_15225       CDS       T06028                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lyg  Lysinibacillus sp. SGAir0095
Pathway
lyg00361  Chlorocyclohexane and chlorobenzene degradation
lyg00625  Chloroalkane and chloroalkene degradation
lyg01100  Metabolic pathways
lyg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C1N55_15225
   00361 Chlorocyclohexane and chlorobenzene degradation
    C1N55_15225
Enzymes [BR:lyg01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     C1N55_15225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6 DUF3986 Tsp45I
Motif
Other DBs
NCBI-ProteinID: QCR33415
UniProt: A0A4P8SG41
Position
complement(3055884..3056624)
Genome map
AA seq 246 aa AA seqDB search
MGQYKTLLFDLDDTLLDFGASEEVALQNLFNDQQFTLTPDIKANYKKINESLWKAYENDE
MDRDEVVNKRFALLFEQYGINVDGVALEKNYRRYLSEGHHSIEGALDLIQRLHTEFDLYI
VTNGASPTQQKRLKDSGLDPYFKKVFVSEDTGYQKPMKGFFDYTFSHIENLDLSKTLIIG
DSFSADVTGGWNAGIDTCWVNIKEQVRLSTEIIPTYEIRKLEEIYGILGIERETDGWESL
LRTAMK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggacaatataaaactttgttatttgatttagatgatactctgctggactttggggct
tcggaggaagtcgccctccaaaacctatttaacgatcaacagtttacattaacacccgac
attaaagcgaattacaaaaaaataaatgagtcattatggaaggcatatgaaaatgatgag
atggaccgggatgaagttgtaaataagcgatttgctctattattcgaacagtatggcatc
aatgtggacggtgtggctttggagaaaaactaccgaagatatctttcggaaggtcatcat
tcaatagagggagcattggatttaattcaaaggctgcatactgaatttgatttatatatt
gtgacaaacggtgcttcacccacacagcaaaaacgcttaaaggattcaggtctagatccg
tattttaaaaaagtattcgtttcagaggatacaggctatcaaaaaccgatgaaaggcttt
ttcgactatactttttctcacatcgaaaatttagatttgagtaaaacgttaatcatcgga
gattcctttagtgctgacgtgacaggcggctggaatgccggaatcgacacttgctgggtt
aacattaaggaacaagtgcgtcttagcactgaaattatacctacctatgaaatccgcaag
ctagaggaaatatacgggatcttagggattgaaagagaaactgacggttgggagagttta
ttgcgaacggccatgaaataa

DBGET integrated database retrieval system