KEGG   Lysinibacillus sp. SGAir0095: C1N55_17085Help
Entry
C1N55_17085       CDS       T06028                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lyg  Lysinibacillus sp. SGAir0095
Pathway
lyg00860  Porphyrin and chlorophyll metabolism
lyg01100  Metabolic pathways
lyg01110  Biosynthesis of secondary metabolites
lyg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lyg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C1N55_17085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lyg01007]
    C1N55_17085
Enzymes [BR:lyg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     C1N55_17085
Amino acid related enzymes [BR:lyg01007]
 Aminotransferase (transaminase)
  Class III
   C1N55_17085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QCR33742
UniProt: A0A4P8S6G5
Position
3442923..3444212
Genome map
AA seq 429 aa AA seqDB search
MNHTKSEEIQIQALEHIVGGVNSPSRSYKAVGGGAPVVMAKGKGQYFWDVDGNRYIDYLA
AYGPIITGFGHPHIAKAIAHAAETGVLYGTPTEHEVKFAKMLKDAIPSLDKVRFTNSGTE
AVMTTVRVARAYTGRTKIIKFAGCYHGHFDQVLVAAGSGPATLGSPDSAGVPVAVATEVI
TVPFNNKEEFQLAMDKWGDEVAAILIEPIVGNFGIVEPQPGFLEFVHATAKEKGALTIHD
EVITAFRFHYGAAQDLLGLTPDLTAMGKIIGGGLPIGAYGGRKEIMETVAPLGPAYQAGT
MAGNPASMLAGIACLEVLKQPGVYEEMDRLGALLEKGILEAAEKHGVPITLNRLKGALTL
YFTNVKVENYEQAENSDGEMFGRFFKLMLSKGVNLAPSKYEAWFLTTEHKEEDIVETIAA
VDYAFSQLI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatactaaatctgaagaaatccaaatacaggctttagagcatatcgttggtgga
gtaaacagtccatcacgttcgtataaagcagttggcggtggtgcacctgttgtcatggca
aaaggaaaaggtcagtacttttgggatgtagacggtaaccgctacattgactacttagct
gcttacggtccaattattacaggatttggtcatccacatatcgcaaaagcaatcgctcac
gctgcggaaacaggtgttttatacggaactcctactgagcatgaagtaaaattcgccaaa
atgttaaaagacgcaattccttctttagataaagtgcgtttcacaaactcaggtacagaa
gcagtaatgacgacagtacgtgttgcccgtgcttatacgggacgtactaaaatcattaaa
tttgctggatgctaccatggacattttgaccaagtactagttgctgccggttccggtcct
gctacactaggctctccagattcagcaggtgtgcctgttgctgtagctactgaagtaatt
acagtgccgtttaataataaagaagaattccaattagcgatggataaatggggcgatgag
gttgcagcaattctaatcgagccaatcgtaggaaactttggtatagttgagcctcaacca
ggattcttagagttcgttcatgcgacagcaaaagaaaaaggtgcactaacaatccatgat
gaagttattaccgctttccgattccattatggtgctgcgcaggatttacttggcttaacg
cctgatcttacagctatgggtaaaattattggtggtggattgccaatcggtgcttatggt
ggtcgtaaagaaattatggaaactgttgcaccacttggacctgcataccaagctggaaca
atggctggaaacccagcgtcgatgcttgcaggaatcgcatgtcttgaagtgttaaaacaa
cctggtgtttacgaagagatggatcgactaggtgccctactcgaaaaaggcattttagaa
gctgcagaaaaacacggtgtaccaattactctcaatcgcttaaaaggggcattaactctg
tactttacaaatgtaaaagttgaaaactacgagcaagccgaaaactctgatggtgaaatg
ttcggtcgcttcttcaaattaatgctttcaaaaggagtaaatcttgctccttctaaatat
gaagcatggttcttaacaactgaacacaaagaagaagatattgtcgaaacaattgcagcc
gtagattatgcattttcacaattaatataa

DBGET integrated database retrieval system