KEGG   Lysinibacillus sp. YS11: LBYS11_05880Help
Entry
LBYS11_05880      CDS       T05299                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys00071  Fatty acid degradation
lys00072  Synthesis and degradation of ketone bodies
lys00280  Valine, leucine and isoleucine degradation
lys00310  Lysine degradation
lys00362  Benzoate degradation
lys00380  Tryptophan metabolism
lys00620  Pyruvate metabolism
lys00630  Glyoxylate and dicarboxylate metabolism
lys00640  Propanoate metabolism
lys00650  Butanoate metabolism
lys00900  Terpenoid backbone biosynthesis
lys01100  Metabolic pathways
lys01110  Biosynthesis of secondary metabolites
lys01120  Microbial metabolism in diverse environments
lys01130  Biosynthesis of antibiotics
lys01200  Carbon metabolism
lys01212  Fatty acid metabolism
lys02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBYS11_05880
   00630 Glyoxylate and dicarboxylate metabolism
    LBYS11_05880
   00640 Propanoate metabolism
    LBYS11_05880
   00650 Butanoate metabolism
    LBYS11_05880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBYS11_05880
   00072 Synthesis and degradation of ketone bodies
    LBYS11_05880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBYS11_05880
   00310 Lysine degradation
    LBYS11_05880
   00380 Tryptophan metabolism
    LBYS11_05880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBYS11_05880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBYS11_05880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBYS11_05880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lys04147]
    LBYS11_05880
Enzymes [BR:lys01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBYS11_05880
Exosome [BR:lys04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBYS11_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: AUS89002
UniProt: A0A2I7Z9L1
Position
1256983..1258170
Genome map
AA seq 395 aa AA seqDB search
MMTNEVVIVSAVRTAIGSFQGTLKDVPATTLGSIVIKEALVRAGVAGEQVDEVIMGNVLS
AGLGQNPARQAAIKAGLPQEVSALTINKVCGSGLKAVHLATQAILAGDAEIVVAGGFENM
SQAPYVLKNAREGFRMGDQKVVDTMIQDGLWCAFNDYHMGITAENLCDMYQISREEQDAF
AARSQQRAEAAIAAGKFENEIVAVEIPQRKGEPLLFNKDEFPRAGVTAESLGKLRPAFKM
DGSVTAANASGINDGAAAVVVMSKEKAQELGIQPIAIITANASAGVDPAIMGTGPVKAVQ
KALTKAEITLNDIDLIEANEAFAAQSIAVDRELSFNHDKLNVNGGAIALGHPIGASGARI
LVTLLHEMEKRDVKTGLATLCIGGGQGVATVVKRP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
attatgacaaacgaggtagtaatcgtgagtgcggtgcgtacagcaatcggctcatttcag
gggacattaaaagacgtaccagcgacaacgttaggtagcattgtcattaaagaggcatta
gtgcgtgctggcgtagcaggagaacaggtcgatgaggtcattatggggaatgttttatcg
gcaggacttggacaaaatccagcgcgtcaagcggcaattaaagcggggttacctcaagag
gtatcagctttaacaattaataaagtatgtggatcaggtttaaaggctgttcatttagca
acacaggcgattttagcgggagatgcagagattgttgttgcaggtggatttgaaaatatg
agccaggctccatatgtcttaaaaaatgcacgagaaggcttccgaatgggcgaccaaaag
gtagtagatacaatgatacaagatggcctatggtgtgcttttaacgattatcatatgggc
attacagctgaaaatttatgtgatatgtatcaaatttctcgagaagagcaggatgctttt
gcagctcgttctcagcaacgcgcagaggcagcaattgcagcgggcaagtttgaaaatgaa
atcgttgctgttgagattccacagcgcaagggagagccactgcttttcaataaagatgaa
tttccacgagcaggtgtgacagcagaatcattaggtaagctacgaccagcatttaaaatg
gatggctctgtcacagcagcgaacgcgtctggaattaatgatggtgcggcagcggtagtg
gtgatgtcaaaggaaaaagcacaagagctaggcattcaaccaattgcgatcattacagcg
aatgctagtgctggtgtagatcctgcaattatgggtacaggtcctgtaaaagcagtacaa
aaagcgctgacaaaggctgagattactttaaacgatatcgatttaattgaagcaaatgaa
gcatttgcagcacaatcaattgctgtagatcgtgaattaagctttaatcatgataaacta
aatgttaacgggggtgctattgctcttggtcacccaatcggtgcaagtggtgctcggatt
ttggtaacgctattacatgagatggaaaagcgtgatgtgaaaacgggcttagccacatta
tgtatcggtggtggacaaggcgtagcaacagttgtgaagcgcccttga

DBGET integrated database retrieval system