KEGG   Lysinibacillus sp. YS11: LBYS11_06400Help
Entry
LBYS11_06400      CDS       T05299                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBYS11_06400
Enzymes [BR:lys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LBYS11_06400
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LBYS11_06400
    1.1.1.-  
     LBYS11_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N Pyr_redox_3 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AUS85984
UniProt: A0A2I7Z107
Position
1354558..1355607
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGVKDIRVEEVELRALREEEVKVKVAWAGICGSDLHEYEEGPVFVPVNEKADLT
GEVAPLTMGHEFAGIIEEVGSKVTDFKAGDRVVINPTLTYRNKHEEVDRYDGFNFIGLHG
NGGFAEYVNVPVTNIHRLADNLTLQDGALVEPMAVAVQAVKDAGVTLGDSVAVFGAGPIG
LLTVIAAKASGASKVIVLDLSDDRLEKAKELGATHAINSGKENPVQAVRAIVADGVDVSF
EVAGVAPTFKQAIDVTKPRGNMMIVSIFARPIEWNPMQLTNTGVNVLSSIVYTPSIFERT
IDAMSAGQLNPQGIITSQIDLDEIVEKGFKTLTNDKTQSKILVEISGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtttggcatggtgtgaaagatattagagttgaagaggttgaattacgc
gctttaagagaagaagaagtgaaagtaaaagtagcgtgggctggtatttgtggaagtgat
ttgcatgaatacgaagaaggtccggttttcgtaccagttaatgaaaaagctgatttaaca
ggtgaagttgccccacttacaatgggacatgaatttgctggtatcatcgaagaagttggc
tctaaggttactgactttaaggctggggaccgagttgtcatcaatcctacattaacatat
agaaataaacatgaagaagtcgatcgttatgatggatttaactttattggtttacatgga
aacggtggatttgcggaatatgttaatgtccctgtaacgaatatacatcgtttagcagat
aacttaacattacaagatggtgcactggtagaaccaatggctgttgctgtacaagctgtt
aaagatgctggggttacattaggtgattctgttgctgtatttggtgctggaccaattgga
ttattaacagtaatcgctgcaaaagcatcaggtgctagtaaagttatcgtattagattta
tccgatgatcgattagaaaaggcaaaagaattaggtgcaacccatgctattaattcaggt
aaagaaaatcctgtacaagcagttcgtgcgattgttgcagatggggttgatgtatccttt
gaggtggcaggagttgctcctacctttaaacaagcaattgatgtaacaaaacctcgtggt
aacatgatgattgtttcgatttttgcaagaccaatcgaatggaatccaatgcaacttaca
aacacaggtgttaatgtattatcatccattgtttatacaccgtcaattttcgaaagaaca
attgatgcaatgagcgctggtcaactaaatccacaagggatcatcacaagtcaaattgac
ctagatgagattgttgaaaaaggattcaaaacgttaacaaatgacaaaacacaatctaaa
attttagtcgaaataagcggagaaaaataa

DBGET integrated database retrieval system