KEGG   Lysinibacillus sp. YS11: LBYS11_08385Help
Entry
LBYS11_08385      CDS       T05299                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBYS11_08385
Enzymes [BR:lys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LBYS11_08385
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LBYS11_08385
    1.1.1.-  
     LBYS11_08385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AUS86351
UniProt: A0A2I7Z202
Position
1764902..1765921
Genome map
AA seq 339 aa AA seqDB search
MKAAKFYGVKDIRVEEAQLPALEPGMVKVKVAFAGICGSDLHEYVGGAYAFRTQPVLGHE
FAGVVVEVAKGVTQTKVGDRVAVEPPIPCGKCDNCRRGYSNLCKRGQSYGYTISGGFAEY
AVVQEENIHLLPDNMSLELGALVEPTAVAVHAVRQSQLKLGDTAAIFGAGPIGLLVLQAV
KAAGASEIFVVEVSDERRQKALELGATYVINPIDTDAVAFIREKTAGGVDVAYDAAGVQA
TFTSGVSAVHPGGEFKIVSVWERPVEFNPNAVVSPEVKISGSFAYVNIFPEVIRLLARGV
IDGQAVITSQIAIEDIVEKGFEALTKDRSQCKILVNMSM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaaaattttacggtgtaaaagatattcgagtagaggaggcacaactgcca
gcactagagccaggcatggtgaaagtaaaagttgcctttgctggaatttgtggtagtgat
ttacatgaatatgttggtggggcttatgcattccgtacacaacccgtattagggcatgaa
tttgcaggtgtcgttgtagaggttgcaaaaggcgttacacagacaaaagtaggagatcgt
gtggcagtggagccaccaattccatgtggtaaatgtgataattgtcgacgtggctattcc
aacttatgtaaacgtggtcaatcttatggctatacaatttctggcggatttgcagaatat
gcagttgtacaagaagaaaatattcaccttcttcctgacaatatgagcctagagctaggc
gcacttgttgaacctacagcagtagcggtacatgcagtgcgtcaaagtcaattaaagcta
ggcgatacagctgctatttttggtgcgggtcctattggattattggtcttgcaggctgtg
aaggcagcgggagcaagtgaaatttttgtcgtagaggtttcggatgaacgacgccaaaaa
gcacttgaattaggcgcgacctatgtcattaatccaattgatacggatgcagtagcgttt
attcgtgaaaaaacagctggtggggtcgatgtagcgtatgatgcagcaggtgtgcaagca
acatttacaagcggtgtgagtgctgttcatccaggcggcgaatttaaaatcgtcagcgta
tgggaaagacctgtagaatttaaccctaatgcggtggtttctccagaggtaaaaatcagt
ggctcgtttgcctatgtgaatattttccctgaagtgattcgattacttgctcgtggtgta
attgatggacaagctgttatcacaagccagattgcaatagaggatatcgtggaaaaaggt
tttgaagctttaacaaaggatcgtagccaatgtaaaattcttgtgaatatgagcatgtaa

DBGET integrated database retrieval system