KEGG   Lysinibacillus sp. YS11: LBYS11_08630Help
Entry
LBYS11_08630      CDS       T05299                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lys  Lysinibacillus sp. YS11
Brite
KEGG Orthology (KO) [BR:lys00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LBYS11_08630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AUS86397
UniProt: A0A2I7Z281
Position
1815043..1816059
Genome map
AA seq 338 aa AA seqDB search
MDTILLITILVVIFALVFDFINGFHDTANAIATSVSTRALKPRTAVYMAAVMNFVGAITF
VGVAKALTKDIVDPFSLNAYDGDITGSVVILAALLSAITWNLLTWYFGIPSSSSHTLIGS
VAGAAIAAAGFDILNYAGFIKILQALIFSPLLAFAAGFLMMTLLKVIFKDMNLYRTNKGF
RTMQIGTAALQSFTHGTNDAQKAMGIITLALIAGGLHQGDDIPFWVRFAAATAMGLGTSV
GGYKIIKTVGGKIMKIRPVNGVAADLASASIIFGATLIHLPVSTTHVISSSIMGVGTAHR
VKGVKWGMARKIVTTWVITMPISAVMAALIYYILSLFF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatacgatcttattaatcaccatattagtcgttattttcgcacttgtgttcgacttt
attaacggcttccatgatacagccaatgcgattgctacctctgtatcgacccgtgcctta
aagccacgtactgcggtttatatggcagcagtaatgaacttcgtcggagcgattacattc
gttggggtagccaaagccctaacaaaagatattgtggacccattttctttaaatgcctat
gatggcgatattacaggttctgttgtgattttagcagccttattatctgccattacatgg
aatttattaacatggtattttgggattccatcaagttcttctcatacattaataggttct
gttgcaggggcagctattgccgcagcaggatttgatattttgaactatgctgggtttatt
aaaattcttcaagcacttattttttcaccattactagcgttcgcagctggtttcctgatg
atgacattattaaaagtcatcttcaaagatatgaatttatatcgaacgaataaaggcttc
cgtacaatgcaaattgggacagcagccttacaatcctttacacacgggacaaatgatgcg
cagaaggcaatgggtattattaccttggcgctaatcgccggcggcctacaccaaggagat
gatattcctttctgggtacgttttgctgcagcaactgcgatgggtcttggtacatctgtc
ggaggctataaaattatcaaaacggttggcggtaaaatcatgaaaatccgcccagtaaat
ggggtagcggcagacttagcttctgcatcgattatctttggtgccacattaatccattta
ccagtttctacaacacatgttatttcttcatccatcatgggtgtcggaacagcacaccgt
gttaaaggcgttaaatgggggatggcacgtaaaatcgttacaacatgggtcatcacgatg
ccaatctctgctgtcatggcagcattgatttactatattctaagtttatttttctag

DBGET integrated database retrieval system