KEGG   Lysinibacillus sp. YS11: LBYS11_13425Help
Entry
LBYS11_13425      CDS       T05299                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys00361  Chlorocyclohexane and chlorobenzene degradation
lys00625  Chloroalkane and chloroalkene degradation
lys01100  Metabolic pathways
lys01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lys00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBYS11_13425
   00361 Chlorocyclohexane and chlorobenzene degradation
    LBYS11_13425
Enzymes [BR:lys01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LBYS11_13425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: AUS87271
UniProt: A0A2I7Z4N6
Position
complement(2698776..2699480)
Genome map
AA seq 234 aa AA seqDB search
MTKYEILLFDVDDTLLDFDLAENAALDRMFREEKIATTPEMIARYKEINESMWRAFERGE
MTKNTLHNTRFAIALKEFGMEVDGVYFESLFQKYLQEAHHYVEGAYEVIAQLANHYHLYV
VSNGVTLTQNKRLVDADLAQYFKGIFISEQTGYQKPMPAFFDYVFERIEHFDKAKTLIIG
DSLTSDIKGGLLSGIDTCWFNIRNVENTSDIEPHYEIKKLHELHELLHTKIALY
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatatgagatattattgtttgacgtagatgatacattactagattttgattta
gctgaaaatgcagcacttgaccgcatgttcagagaggaaaagatagccactacgcccgag
atgattgcgcgctacaaagaaattaatgaatcgatgtggcgagcttttgagcgtggggaa
atgacaaaaaatacactacataatacaaggtttgcgattgcattaaaggaatttgggatg
gaggtcgatggcgtctactttgaatcgctattccaaaaatacttacaggaagcacatcat
tatgtagagggagcctatgaagtcatcgctcaactagccaatcactatcatttgtatgtc
gtatcaaatggcgtaacgctgacacagaataaacgactagtggatgccgatttagcacaa
tattttaaaggcatctttatctccgagcaaacgggctatcaaaaaccaatgcctgccttt
tttgattatgtatttgagcggattgagcattttgataaagctaaaacgcttataatcggc
gattctttgacatcagacattaaaggcggattgctgtcaggcattgatacatgctggttt
aacatccgcaatgttgaaaatacgagtgatattgaaccgcattatgaaattaaaaaattg
catgagttacatgagctattgcatacaaaaatagcactatattaa

DBGET integrated database retrieval system