KEGG   Lysinibacillus sp. YS11: LBYS11_22175Help
Entry
LBYS11_22175      CDS       T05299                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lys  Lysinibacillus sp. YS11
Pathway
lys03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lys00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LBYS11_22175 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lys03011]
    LBYS11_22175 (rplV)
Ribosome [BR:lys03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LBYS11_22175 (rplV)
  Bacteria
    LBYS11_22175 (rplV)
  Archaea
    LBYS11_22175 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUS88810
UniProt: A0A2I7Z918
Position
complement(4412540..4412884)
Genome map
AA seq 114 aa AA seqDB search
MTQAKAIARTVRIAPRKVRLVVDLIRGKQVGEAVAILRHTPKAASPVVEKVLKSAVANAE
HNYDLDINSLVVSEVFVDEGPTLKRFRPRAQGRASAINKRTSHITLVVSEKKEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctaaagctatcgctcgtacagtacgcattgctcctcgcaaagtacgtcta
gttgtagacttaatccgaggtaagcaagttggtgaagcagttgcaattttacgtcatact
ccaaaagcggcgtctccagtcgttgagaaagtattaaaatctgcagttgctaacgctgag
cacaactacgatcttgacatcaactctttagtagtttctgaagtattcgttgacgaaggt
ccaactttaaaacgtttccgtccacgtgcacaaggacgtgcaagcgcaattaacaaacgc
acaagccacattactctagtggtatctgagaagaaggagggttaa

DBGET integrated database retrieval system