KEGG   Lysobacter sp. TY2-98: DWG18_05865Help
Entry
DWG18_05865       CDS       T05586                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
lyt  Lysobacter sp. TY2-98
Pathway
lyt00230  Purine metabolism
lyt00240  Pyrimidine metabolism
lyt00760  Nicotinate and nicotinamide metabolism
lyt01100  Metabolic pathways
lyt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lyt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DWG18_05865
   00240 Pyrimidine metabolism
    DWG18_05865
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DWG18_05865
Enzymes [BR:lyt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     DWG18_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-ProteinID: AXK71859
UniProt: A0A345ZJD4
Position
complement(1245600..1246529)
Genome map
AA seq 309 aa AA seqDB search
MPDRDADPLIVAISSRTLFDLEESHDLFEREGLEAYASFQRGHENDVLAPGIAFPLVRKL
LRLNEGAPPEAPRVEVILISRNSADTGLRIFNSIAHHGLSIRRAAFSNGAPPYPYIRPFN
ADLFLSAHGEDVRAALEAGVAAAMLLPSTSRSAASAAARYPDQLRIAFDGDAVIFDDEGE
RVSREGGLAAFAEHEMQRAGEPLSGGPFRGFLDALHRLQQAFPTGEDAPIRTALVTARSV
PAHERVIRTLREWGIRLDEALFLGGRAKGPFLEAFGADIFFDDSEHNIVSARDHVAAGHV
PHGVANTPR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccgcgatgccgatcccctgatcgttgccatttcctcccgaacgctgttcgac
ctggaggaaagccacgacctgttcgaacgcgaaggcctcgaggcctacgcgagtttccag
cgcggtcacgagaacgacgtgctggcgcccggcatcgcgttcccgctggtgcgcaagctg
ctgcgcctcaacgagggtgcgccgccggaggcgccgcgcgtcgaagtgatcctgatctcg
cgcaattcggccgacaccggcctgcgcatcttcaattccatcgcgcaccacggcctgtcg
atccgtcgtgccgccttcagcaatggcgcgccgccgtatccctacatccggccgttcaat
gcggatctgtttctgtcggcgcacggcgaggatgtgcgtgcagcgctcgaggccggcgtc
gccgcggcgatgttgttgccgtcgacgtcgcgatcggctgcgtcagcggctgcgcgctat
ccggaccagctgcgcatcgccttcgatggcgacgcggtgatcttcgacgacgagggcgag
cgcgtgtcgcgcgaaggcggactcgccgcgttcgcggaacatgagatgcagcgtgctggc
gagccgctctcgggcggtccgttccggggtttcctcgatgcactgcatcgccttcagcag
gcgtttcccaccggcgaggatgcaccgatccgcaccgcgcttgtcacggcccgcagcgtg
cccgcacacgaacgcgtgatccgcacgctgcgcgagtggggcatccgcctggacgaggcg
ctgtttctcggtggccgcgcgaaggggccgttcctcgaagccttcggtgccgacatcttc
ttcgacgattcagaacacaacatcgtctcggcgcgcgaccacgtcgccgccggacacgtg
ccgcacggcgttgcgaatacgccgcgctag

DBGET integrated database retrieval system