KEGG   Lysobacter sp. TY2-98: DWG18_06390Help
Entry
DWG18_06390       CDS       T05586                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lyt  Lysobacter sp. TY2-98
Pathway
lyt00450  Selenocompound metabolism
lyt00970  Aminoacyl-tRNA biosynthesis
lyt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lyt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DWG18_06390
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DWG18_06390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lyt01007]
    DWG18_06390
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lyt03016]
    DWG18_06390
Enzymes [BR:lyt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DWG18_06390
Amino acid related enzymes [BR:lyt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DWG18_06390
Transfer RNA biogenesis [BR:lyt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DWG18_06390
 Prokaryotic type
   Other AARSs
    DWG18_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f DUF1610 zf-C2H2_3
Motif
Other DBs
NCBI-ProteinID: AXK71949
UniProt: A0A345ZJM4
Position
1367794..1369878
Genome map
AA seq 694 aa AA seqDB search
MSREILVTCALPYANGPLHLGHLVGYVQGDIWTRARRMSGHTVHFVCADDTHGTPIMLAA
EKAGTTPEAFIAGIQASHERDFADFGVAFDHYDSTNSDTNRELTQSIYRALEAEGHITRR
AVAQLFDPVKGMFLPDRYVKGICPNCGTPDQYGDNCENCGATYAPTELEDPRSVISGATP
ELRESEHFFFELGHFDAFLREWLSGDVAIAGVKAKLQEWLDAEGGLRAWDISRDAPYFGF
EIPGHPGKFLYVWIDAPIGYLASFKALAAQRGIDFESFLRADSQAEMHHFIGKDIVNFHG
LFWPAVLHGAGLRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTYLDCGLDPEALRYYFAA
KTSGGVDDVDLNLADFIARVNSDIVGKFVNLASRCAGFIEKRFGGRLADALPDAGMYERF
VAQLQPIADGYARNEAATALRLTMTLADEANRYIDETKPWVLAKQDGAEAELQAVCTQGL
NLFRVLAVALKPVLPRVATQAEGFLRAPVAWWGDVAAPLLAREIAPYTPLFTRIDPKQID
AMTDASKDTLQTTDAKPAANTTAKTDAAAGTAPAAPKADAAGAAAHIGIDDFAKLDLRIG
KVLECAFVEGSDKLLRFLLDAGDLGQRQIFSGIRGSYGEPEKLVGRSVVFIANLAPRKMR
FGVSEGMILSAGFDGGGLFLLDADSGAAPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgagatcctggtcacctgcgccctgccctacgccaacggcccgctgcacctc
gggcacctggtgggctacgtccaaggcgatatctggacgcgcgcacggcgcatgtcgggc
cacaccgtgcacttcgtctgcgccgacgacacccatggcacgccgatcatgctcgccgcc
gagaaggccggcacgacgccggaggccttcatcgccggcatccaggccagccacgaacgt
gacttcgccgacttcggcgtcgcgttcgatcactacgactcgaccaactccgacaccaac
cgcgagctgacccagtcgatctaccgcgcgctcgaggccgaaggccacatcacgcggcgc
gcggtcgcgcagctgttcgacccggtcaagggcatgtttctgcccgaccgctacgtgaag
ggcatctgcccgaattgcggcacgcccgaccagtacggcgacaactgcgagaactgcggt
gcgacgtacgcaccgacggaactcgaggatccgcgctcggtcatcagcggcgcgacgccg
gagctccgcgagtccgagcatttcttcttcgagctcggccattttgacgcattcctgcgc
gagtggttgtccggcgacgtcgccatcgccggagtcaaggcgaagctgcaggaatggctc
gacgccgagggcggactgcgggcgtgggatatctcccgcgacgcgccctacttcggcttc
gagatcccgggccatccgggcaagttcctctacgtctggatcgacgcaccgatcggctac
ctcgcgagcttcaaggcgctggccgcgcagcgcggcatcgatttcgaatcgttcctgcgc
gcggactcgcaggccgagatgcaccacttcatcggcaaggacatcgtcaatttccacggc
ctgttctggcccgcggtactgcacggtgccggcctgcgcgcaccgacgcgcctgcacgtc
aacggttacctgacggtggacggcgcgaagatgtcgaagtcgcgcggcaccttcgtcatg
gcgcgtacgtatctcgactgcggcctcgatcccgaagcgctgcgctactacttcgcggcc
aagacctccggtggcgtcgatgacgtcgacctcaacctcgccgacttcatcgcgcgcgtg
aactccgacatcgtcggcaaattcgtgaacctggcgagccgctgcgcaggtttcatcgag
aagcgattcggcggtcgcctcgccgatgcgttgccggacgccgggatgtacgagcgtttc
gtcgcccagctccagccgatcgccgacggctacgcacgcaacgaagccgcgacggcgctg
cgcctgacgatgacgctggccgatgaagccaaccgctacatcgacgaaaccaagccgtgg
gtgctcgccaagcaggacggcgccgaggccgagctgcaggcggtgtgcacgcagggcctc
aacttgttccgcgtgctcgccgttgcgctcaagccggtgctgccgcgcgtcgcgacgcag
gcggaaggcttccttcgcgcgccagtggcgtggtggggcgatgtcgccgcaccgctcttg
gcgcgtgagatcgcgccctacaccccgctcttcacccgtatcgacccgaaacagatcgac
gccatgaccgacgccagcaaggacaccctgcagaccaccgacgccaagccggcggcgaac
acgacggcgaagaccgacgccgcggcgggcactgcgcctgccgcgccgaaggcggacgcc
gccggtgccgctgcccacatcggcatcgacgatttcgcgaagctcgacctgcgcatcggc
aaggtgctcgagtgcgcattcgttgaaggttcggacaagctgctgcgtttcctgctcgat
gcgggcgaccttggccagcgccagatcttctcgggaatccgcggctcctacggcgagccg
gaaaagctcgtgggtcgcagcgtggtcttcatcgcgaacctggcgccgcgcaagatgcgc
ttcggcgtgagcgagggaatgatcctgtcggccggcttcgacggcggcgggctgttcctg
ctggacgccgacagcggtgccgcgccgggcatgccggttcgctga

DBGET integrated database retrieval system