KEGG   Lysinibacillus sp. 2017: DCE79_01755Help
Entry
DCE79_01755       CDS       T05455                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz00360  Phenylalanine metabolism
lyz00362  Benzoate degradation
lyz00621  Dioxin degradation
lyz00622  Xylene degradation
lyz01100  Metabolic pathways
lyz01120  Microbial metabolism in diverse environments
lyz01220  Degradation of aromatic compounds
Module
lyz_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DCE79_01755 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DCE79_01755 (dmpG)
   00622 Xylene degradation
    DCE79_01755 (dmpG)
   00621 Dioxin degradation
    DCE79_01755 (dmpG)
Enzymes [BR:lyz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     DCE79_01755 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Glyco_trans_4_5 ANF_receptor
Motif
Other DBs
NCBI-ProteinID: AWE06184
UniProt: A0A2S1GXQ9
Position
377262..378275
Genome map
AA seq 337 aa AA seqDB search
MKKLLITEVALRDGSHVVGHQFTKEQVRTVTKQLSAAGVPYIEVTHGDGLGGSSLQYGFS
KEYDIELVKVAVEEAGNSIISVLLLPGIGTIKDLEKAYDAGARMVRVATHVTEADVSKQH
IETAKEMGMEAVGFLMMAHSAPPEVVLEQAKLMESYGAKVVYVTDSAGAMLPNDVTARIS
LLKAHLSVDIGFHAHNNLSLAVANTLAAIEAGATYIDGSVCCLGAGAGNTQTEVLVGVLD
RLGYETGIDLYKMLDLADDVRANILPAPQDITSGSFIMGYAGVYSSFLRHAVVAAEKFDV
DARDILVELGKREVVGGQEDMIIEVAQQMAGKRVSVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttgttgataacagaagtagcgttacgtgatggaagccatgttgtagggcat
caattcacaaaagagcaagtacgcactgtaacaaaacaactaagcgctgccggtgttcct
tatattgaagtgacgcacggcgatggtttaggtggctcctctttacagtacggcttttca
aaggaatatgacatcgagcttgtgaaggtagcagtggaagaagcgggcaattcaataatt
tctgttttgctgttacctggtatcggtacaatcaaggatttagaaaaggcatacgatgcg
ggtgctcgcatggtacgagtagcaacacatgtaacagaggcggatgtttcaaagcagcat
attgaaacagcaaaagagatggggatggaggctgttggctttttaatgatggcgcacagt
gccccaccagaagttgttttggagcaggcaaagctcatggaatcgtacggggcaaaagtt
gtttatgttacggactctgcaggtgcaatgctgccgaatgatgtaacagcacgtattagt
ttgctaaaggcgcatttgtctgtagatatcggctttcatgcgcacaataacctttcatta
gcggtggccaataccctcgcagcaattgaggcaggcgcaacctatattgatgggagcgtg
tgctgtttaggtgcaggtgcaggaaatacgcaaacagaagtgttagttggtgtattagac
cgcttgggttatgaaacgggcatcgatctttacaaaatgctcgacttagcagatgatgtg
cgcgccaatattttaccagctccacaagatatcacgagcggtagtttcattatgggctat
gccggcgtctattcaagcttcttgcgtcatgcagtcgtagcagccgaaaaatttgatgta
gatgcacgcgatattttagtcgagcttggtaagcgtgaagtcgtcggtggacaagaagat
atgattattgaagtagcacaacaaatggcgggaaaaagggtgagtgtattgtga

DBGET integrated database retrieval system