KEGG   Lysinibacillus sp. 2017: DCE79_04090Help
Entry
DCE79_04090       CDS       T05455                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz00020  Citrate cycle (TCA cycle)
lyz00620  Pyruvate metabolism
lyz00650  Butanoate metabolism
lyz01100  Metabolic pathways
lyz01110  Biosynthesis of secondary metabolites
lyz01120  Microbial metabolism in diverse environments
lyz01130  Biosynthesis of antibiotics
lyz01200  Carbon metabolism
Module
lyz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lyz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DCE79_04090
   00620 Pyruvate metabolism
    DCE79_04090
   00650 Butanoate metabolism
    DCE79_04090
Enzymes [BR:lyz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     DCE79_04090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AWE06617
UniProt: A0A2S1GZ27
Position
926228..927727
Genome map
AA seq 499 aa AA seqDB search
MGTVINDRIRYQGLADKVVSAETAASWIKDGMVLGMSGFTRAGDAKTVPLALVEKAKKEK
FQVDVYTGASLGPEVDQLMAEAGIIRKRAPYQGDPAIRKAINTGQVLYSDMHLSHNAELI
RQGIIGPIDFAIIEATAITEDGQIIPTTSIGNSPILVQMAKEIIIELNPEQPNLEGIHDI
YLPGMQGERDPIPLLKASDRIGTVGIPVDVNKIKGIVHSTIKDAPSLIVEPDEETEKIAQ
HLLAFLRDEIIVGRLPKNLLPLQSGVGSVANAVLNGFLDSEFEELEIYSEVLQDAVFHLL
DANKVKIASGTSITLSKECGDRVYSNIDQYKDRLVLRPQEISNHPELIRRLGIIAINTAL
EVDIYGNVNSTHVMGTHMMNGLGGSGDFTRNARIGIFVTKSYAKGGDISSIVPMVAHHDH
TEHDVDVIATEQGIADLRGMAPRERVEAIIKNCVHPDFKEALRDYYNRAIEVSGNAHTPH
NLEEALAWHVQYKNKKTMK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggcacagttataaatgatcgaattcgttatcaaggattagcggataaggtggtatcc
gcggaaacggcagcttcgtggattaaggatgggatggtactaggcatgagtgggttcact
cgtgctggcgatgccaaaactgtcccgctagcgcttgttgaaaaagcaaaaaaggaaaag
tttcaagtagatgtttacacaggtgcgtcacttggtccagaagtggatcaattgatggcg
gaagctggaattatccgcaagcgcgctccttatcaaggggatcctgccattcgtaaagct
attaacacagggcaagtactttattctgatatgcacttatcacataatgctgaactaatt
cgtcaaggcattatcggtccaatcgactttgctattattgaggcaacagcaattacagag
gacggccaaatcattccaacaacttcaattggtaactcgcctattcttgtgcaaatggcg
aaagaaattattatcgaattaaatcctgaacaaccgaatttagaaggcatccatgatatt
tatttaccaggtatgcaaggagaacgggatccaatcccattactcaaagcaagtgatcgt
attggaacagtaggtatcccagttgatgtcaacaaaattaaagggattgttcattcaaca
attaaagacgcaccatcattaatcgttgagccagatgaagaaacggaaaaaatcgcacag
catttattagcattcctacgcgatgaaatcatagtagggcgcttaccgaaaaacctattg
ccactgcaatcgggtgtaggctctgtagcaaatgctgtactaaatggctttttggattct
gaatttgaagagttagaaatttactctgaagttttacaagatgctgtattccatttactt
gatgcaaataaggtgaaaattgcctcaggtacatcgattacattaagtaaagaatgtggc
gaccgcgtatacagcaatattgatcaatacaaagatcgtttagttttacgaccacaagaa
atatcgaatcatccagaacttattcgtcgtttaggaattattgcgattaatacagcgctt
gaagtcgatatttatggcaatgtcaattcaacgcatgtaatgggcacacatatgatgaat
ggattaggcggttctggagatttcacacgtaatgctcgtatcggtatttttgtaacgaag
tcttatgcaaaaggtggcgatatttcatcaatcgtcccgatggttgcacaccatgaccat
acggagcatgatgttgatgttattgcgacagaacaagggattgctgatttacgtggaatg
gccccaagagaacgagtggaggcaattattaaaaactgtgtacatccagattttaaagag
gcacttcgcgattattataaccgtgcgattgaagtatcaggaaatgcgcatacgccgcat
aacttagaagaagcgttagcttggcatgtacaatataaaaataaaaaaacaatgaaataa

DBGET integrated database retrieval system