KEGG   Lysinibacillus sp. 2017: DCE79_12840Help
Entry
DCE79_12840       CDS       T05455                                 

Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz00230  Purine metabolism
lyz00240  Pyrimidine metabolism
lyz00760  Nicotinate and nicotinamide metabolism
lyz01100  Metabolic pathways
lyz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DCE79_12840
   00240 Pyrimidine metabolism
    DCE79_12840
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DCE79_12840
Enzymes [BR:lyz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     DCE79_12840
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     DCE79_12840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AWE09299
UniProt: A0A2S1H7A5
Position
complement(2627814..2629331)
Genome map
AA seq 505 aa AA seqDB search
MHSNDTHANLNQIAKKVTAVKEVRASKPKSLLVDAGDVFSGTLYFNEFKGSTDLKFMNLM
GYDIMTFGNHEFDLGSSVEGHQALVNFIKGAKFPFVSSNIDFSRDAKFTGLFSDLISSNP
KNGKIYNGIVKEIDGEKVGFFGLTTAETRDISSPGSIFFENYIEEAKKAVRAFEGMGVNK
IVAISHIGHDDNPAIDNDLILASKVEGIDVIVGGHSHTQLDKPLVVDSDGTPTIIVQAYQ
YNEYLGTLDVEFDKRGVVVRHDGKLIKIADKVEDWEATKLLQPYKSKIDQIAAQEIGAVA
VKAFENPRTEGESVRRNETPLGNLITDGMLQKAKTYNSNVIMAFQNGGGIRAGINQGPIT
IGEVMTVLPFGNTLATMNLTGAEIKQTFEISLKDLPLENGGFLHVSGAKVEYDSSRSVGR
RVVSIKYKNAGNTYTELLDNTTYTIATNAFTAKGGDGYTVLAKAYGEGRVKDLGLSDWEN
FRDYLVSLRTVDTKVEGRLVDIARR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaatgatacacatgcgaatttaaatcaaattgcgaaaaaagtgaccgctgtc
aaggaagtgcgcgcgtctaaaccaaaatcattacttgtagatgcgggagatgtgttctct
ggaactttatattttaatgaatttaaaggatcaacagacctgaagtttatgaatttaatg
ggctatgacattatgacatttggtaaccatgaatttgatttaggttcgagtgtggaagga
catcaagcattagtaaattttatcaaaggtgcaaagttcccgtttgttagttcgaatatt
gatttttcaagggatgccaaatttactggtttattcagcgacttgatatcaagtaatcca
aaaaacggaaaaatttataatgggattgtaaaagaaatcgacggggaaaaggtcggattc
tttggcctaacaactgcagagacacgtgatatttcaagtccagggtctattttctttgag
aactatatcgaagaagcaaaaaaggctgtcagagcatttgagggaatgggtgtcaataaa
attgttgcaatctctcatattggacacgatgacaacccagccattgacaacgatttaatt
ttagcatcaaaggtcgaaggaattgatgtgattgttggaggacatagccatacacaattg
gataagccgcttgtcgttgatagtgatggaacaccaacgattattgtgcaagcctatcaa
tataacgaatatctaggaacactagatgttgaatttgataaaagaggcgttgttgttcgt
cacgatggcaaattaattaaaatagctgataaagtggaagattgggaggctacgaagcta
cttcaaccgtataaatcaaaaatagaccaaattgcagctcaagaaataggggcagttgct
gtgaaggcatttgaaaatccgcgaacagagggcgaaagtgttcgacgaaatgaaaccccg
ttaggcaacttaatcacggacggtatgctacagaaagcgaaaacgtataattcgaacgtc
atcatggcattccaaaatggtggaggaattagagccggaatcaatcaaggaccgattact
attggtgaagtgatgacggtgctaccatttggaaacacattagcaacgatgaatttaaca
ggagcagaaataaaacaaacatttgaaattagtttgaaagacctcccattagaaaatggc
ggattcttacatgtatcgggtgcaaaagtagaatatgattcttctcgatctgttggaaga
cgggttgtttcaataaaatataaaaatgcaggaaacacttacacggaacttctagataat
acaacatacacgattgcaacaaacgcctttacagcgaagggcggggatggctatacagta
ttagctaaagcatatggggaagggcgagtgaaggacttaggattatctgattgggaaaac
ttccgtgattatcttgttagtctgagaactgtcgataccaaagtagagggacgtcttgta
gatatagcaagaaggtaa

DBGET integrated database retrieval system