KEGG   Lysinibacillus sp. 2017: DCE79_15875Help
Entry
DCE79_15875       CDS       T05455                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DCE79_15875
Enzymes [BR:lyz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DCE79_15875
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DCE79_15875
    1.1.1.-  
     DCE79_15875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C IPI_T4 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AWE08742
UniProt: A0A2S1H522
Position
3231651..3232706
Genome map
AA seq 351 aa AA seqDB search
MKAARWYKAKDIRVEQIEEPQVTAGRVKIEVAWTGICGSDLHEYIAGPIFVPVDAPHPVS
KDIAPIVMGHEFSGTVVEIGEGVSSVKVGDQVVVEPILACGECAACKKGKYNICKHLGFH
GLSGGGGGFSEFTVVDERWVHKMPESLSLEQGALVEPAAVALHAVRMSKLKAGDKAVVFG
VGPIGLLVIEALKVAGASEIYAVELSKERGAKALELGATAIINPAQEADVVGKIQQLTNG
GADVAFEVTGVPVVLKQAIDSTSFEGETIIVSIWEKEASIQPNNIVLSERSVKGIIAYRD
IFPAVMHLMTQGYFPADKLVTKRITLDEVVTEGFETLVNDKNQIKILVASK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgttggtataaagcaaaagatattcgagtagaacaaatcgaagaacca
caagtaacagctggtcgtgtaaaaattgaagtggcatggacaggtatttgtggtagcgat
ctacatgaatatattgctggaccaatcttcgtaccagtagatgcaccacatccagtgagt
aaagatattgcccctatagttatgggtcatgagttttcaggtacagtagtagaaattggt
gaaggtgtttcttctgtaaaagtaggagatcaagtcgttgttgagccgattttagcttgc
ggtgaatgcgctgcatgtaaaaaaggaaagtataatatttgtaagcatttaggattccac
ggtttatctggtggtggtggtggattctctgaatttacagtagttgatgagcgttgggtt
cacaaaatgccagaaagtctatcattagaacaaggcgcattagtagagccagcagccgtt
gctttacatgctgtacgtatgagtaaattaaaagctggtgacaaagcggttgtattcggt
gtaggcccaattggattattagtaatcgaagcattaaaggttgccggtgcttctgaaatt
tatgcagttgaattatcaaaagagcgcggtgcaaaagcattagaacttggcgcgacagct
attattaaccctgcacaagaagcagatgttgtcggtaaaattcaacaattaacaaatggt
ggtgcggacgtagcattcgaagttactggtgtacccgttgtattaaaacaagcaatcgat
tctacttcatttgaaggtgaaacgattatcgtttcgatttgggaaaaagaagcttcgatt
cagccaaacaatatcgtgttatcagagcgtagcgtaaaaggaattatcgcataccgtgat
attttccctgcagttatgcacttaatgacacaaggttacttccctgctgacaagcttgtt
actaaacgcattacattagatgaagttgtaacagaaggcttcgaaacattagtaaatgac
aaaaaccaaattaaaatcttagttgcttctaaataa

DBGET integrated database retrieval system