KEGG   Lysinibacillus sp. 2017: DCE79_17265Help
Entry
DCE79_17265       CDS       T05455                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lyz  Lysinibacillus sp. 2017
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lyz03009]
    DCE79_17265
Enzymes [BR:lyz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     DCE79_17265
Ribosome biogenesis [BR:lyz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DCE79_17265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 MetW Methyltransf_4 CMAS
Motif
Other DBs
NCBI-ProteinID: AWE08983
UniProt: A0A2S1H5N2
Position
complement(3532164..3533003)
Genome map
AA seq 279 aa AA seqDB search
MGLLSKRALSIQQIQQHIEIFACPICKTQMEINEEGKMSCQSNHSFDVAKQGYLYLLNRP
VHSMYGKELFESRHAVIDSGIYDPMQKAIVDEIKMPSPIVLDTGCGEGSHLHRICQQIDG
VIGIGVDISKEGIVAAAKFYADELWCVGDLANSPYSAGSFDTILNILSPANYEEFKRLLK
PGGKVLKIVPQENYLKELRVQAFADSEKESYTNAQTVERFKDSFTHTEVKRITYTVPLSQ
ELVPKLLEMTPMGWHIEHKESIQLQQITIDLDLLIGMER
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggtctattatcaaaacgagcgttaagtattcaacaaatacaacaacatatagaaatt
tttgcgtgtcctatttgtaaaacacaaatggagattaatgaagaaggaaaaatgagctgc
caatcgaatcattcgtttgatgtagcaaaacaaggctatttatatttactaaaccgcccc
gttcattcgatgtacggaaaagaattattcgagtcacgccatgccgtcattgattcgggt
atttacgatccgatgcaaaaagcaattgtcgatgaaattaaaatgccatcaccaattgta
ctggatacaggttgcggagagggttcacatttacaccgtatttgccaacaaatagacgga
gtaatcggaatcggtgttgatatttcaaaagagggcattgtcgcggctgcaaaattttat
gccgacgaactttggtgtgtgggagatttagcaaatagtccatacagcgcgggttcattt
gatacgattttaaatattttatcacccgcaaactatgaagaatttaagcggttattgaag
ccgggtgggaaagtactgaaaattgtcccacaagaaaattatttaaaggaattacgtgtg
caggcatttgccgattcagaaaaagaaagctatacgaacgcccaaactgttgagcgtttt
aaagatagttttacccatactgaagtaaagcgtattacgtatacggtaccgctatcacag
gagctcgttccaaaattacttgaaatgactccgatggggtggcatattgaacataaagaa
agcattcaattacaacaaattacgattgatttagatttattaattggaatggagcgttaa

DBGET integrated database retrieval system