KEGG   Lysinibacillus sp. 2017: DCE79_17830Help
Entry
DCE79_17830       CDS       T05455                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lyz  Lysinibacillus sp. 2017
Pathway
lyz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lyz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DCE79_17830 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lyz03011]
    DCE79_17830 (rplV)
Ribosome [BR:lyz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DCE79_17830 (rplV)
  Bacteria
    DCE79_17830 (rplV)
  Archaea
    DCE79_17830 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWE09080
UniProt: A0A2S1H5Z7
Position
complement(3625536..3625880)
Genome map
AA seq 114 aa AA seqDB search
MTQAKAIARTVRIAPRKVRLVVDLIRGKQIGEAVAILRHTPKAASPVVEKVLKSAVANAE
HNYELDMNNLVVSEIFVDEGPTLKRFRPRAQGRASAINKRTSHITIVVSEKKEG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctaaagctatcgctcgtacagttcgtatcgctcctcgtaaagttcgtcta
gtagtagacttaattcgaggaaagcaaatcggtgaagcagttgcaattttacgtcatact
ccaaaagcggcgtctccagtcgttgagaaagtattaaaatctgcagttgctaacgctgaa
cataactacgagttagatatgaacaacttagttgtatctgaaatctttgttgatgaaggt
ccaacattaaaacgtttccgtccgcgtgcacaaggtcgtgcatcggcaattaacaaacgt
acaagccacattacaatcgtggtatctgagaagaaggagggataa

DBGET integrated database retrieval system