KEGG   Lactobacillus zymae: LZ3411_0621Help
Entry
LZ3411_0621       CDS       T05206                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
lzy  Lactobacillus zymae
Pathway
lzy00670  One carbon pool by folate
lzy01100  Metabolic pathways
lzy01120  Microbial metabolism in diverse environments
lzy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lzy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LZ3411_0621
Enzymes [BR:lzy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LZ3411_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: SMS13671
UniProt: A0A1Y6JX28
Position
I:701977..702840
Genome map
AA seq 287 aa AA seqDB search
MDPAKPELSFEVFPPSSPAGTAKLTQTLAQLKGIAPSFVSVTCSNHQLNYEQSTIALAQA
VHRDLRCATMVHMPAAYVTKAQVRQILDQLEAAHIQQVLALRGDLDGAAPETDFTHASDL
VRFIKRVKPQFRVTGACYPEVHPDSPDRVADIRNLKAKVDAGCDQLITQLFYDNAQFYRF
REACAIAGITVPILAGIMPITNRQQALHVVQNCAASLPPKFRAILDKYRDNPVALREAGL
AYAVDQIVDLVTHDVAGIHLYTLNQAATAQHIYDNTASLFAPVTVAD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggacccagccaaaccagaattatcgtttgaggtctttccgcccagttcaccggcggga
acggcgaaactcacgcagacgctggcccaactgaagggcatcgcccccagtttcgtcagt
gtgacctgtagtaatcaccaactgaactacgaacaaagtaccattgcgttggcccaggcc
gttcaccgggacctccggtgtgcgaccatggtccacatgccggcggcctacgtgacgaag
gcgcaggtgcggcagatcctcgaccagctcgaggccgcccacatccagcaggtgttagcg
ctacgcggcgatttggatggcgcggcgccggaaacggacttcacccacgccagcgacctg
gtccggtttatcaaacgggtcaaaccgcagtttcgggtaacgggggcctgctaccccgag
gtccatccggattccccggaccgggtcgccgatatccggaacctgaaggccaaggtcgat
gcggggtgtgaccagctgatcacccagctcttctacgacaatgcccagttctatcggttt
cgagaagcctgtgcgattgccggcattaccgtgccgattctggcgggtatcatgccgatt
accaaccgccaacaggcccttcacgtggttcagaattgcgcggctagtctgcccccgaaa
ttcagggcgattctggataagtaccgggacaatccggtggcgttacgggaagccggcttg
gcctacgcggtggatcagattgtcgatctggtcacccatgacgtggcgggaatccacctg
tacacgttgaatcaggcggcaacggcgcaacacatctacgacaacacggcgtcgttattt
gccccggtgacggtggcagattaa

DBGET integrated database retrieval system