KEGG   Lactobacillus zymae: LZ3411_0857Help
Entry
LZ3411_0857       CDS       T05206                                 

Definition
(GenBank) Glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
lzy  Lactobacillus zymae
Pathway
lzy00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lzy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LZ3411_0857
Enzymes [BR:lzy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     LZ3411_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn AlcCBM31 Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: SMS13907
UniProt: A0A1Y6JVB6
Position
I:957642..958058
Genome map
AA seq 138 aa AA seqDB search
MKKVITYGTFDLLHKGHIRLLKRAKALGDDLTVCLSSDEFNAEKGKRAYTSYEDRKYILE
AIRYVDRVIPEKGWDQKIRDVQDNDIDIFVMGDDWKGKFDFLKDYCEVIYLPRTEGISTT
KIKHDLGLADDEAWKEED
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaattacgtacggaacgtttgacttgctccacaaggggcacatccggtta
ttgaagcgcgccaaggccttgggcgatgatttgaccgtgtgcttatcttccgacgaattc
aatgccgaaaagggtaagcgggcttacacgtcctatgaagaccggaaatacattctcgaa
gctatccgttacgttgaccgggtcatccctgaaaagggttgggaccagaagattcgtgac
gttcaagacaacgacatcgatatttttgtgatgggtgacgactggaaagggaagttcgac
ttcttgaaggactactgtgaagtcatctacctgccccggaccgaaggcatttcgaccact
aagatcaagcacgacttgggcttagcggacgacgaagcctggaaggaagaagattag

DBGET integrated database retrieval system