KEGG   Lactobacillus zymae: LZ3411_0949Help
Entry
LZ3411_0949       CDS       T05206                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lzy  Lactobacillus zymae
Brite
KEGG Orthology (KO) [BR:lzy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lzy03009]
    LZ3411_0949
Enzymes [BR:lzy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     LZ3411_0949
Ribosome biogenesis [BR:lzy03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LZ3411_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 MTS Methyltransf_12 MetW Methyltransf_4 PrmA
Motif
Other DBs
NCBI-ProteinID: SMS13999
UniProt: A0A1Y6JVP1
Position
I:1063918..1064817
Genome map
AA seq 299 aa AA seqDB search
MLLSGDWSAKKFMKKIDRAAAFLGQHVGLFRCPVCHDPYDHVAEHSLVCPQGHNVDLSKK
GMLYFMQRAVASEYDDAMLAARRRMLQAGLFTGITDAFAAHLPATPQTILDVGCGEGTPL
AAVLAHRNGQDTAVGFDISKPGINLATQLETKAFFCVADLAQMPFTDQQFTAVLDLFSPS
AYKEFNRIIAPGGQLLKVIPNADYLIELRQAIFPAGNAHAQYDNSNVLELFKQHYPQATS
ERIRYQVPVAPERFADLMLMTPMHWGADQDRLDQVAAQPFPAITVDVTLLCAQPSEVNR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcagtggtgattggagcgcgaaaaagtttatgaaaaagattgatcgggccgcg
gcctttttaggccagcacgtcggccttttccgttgtcccgtgtgtcacgacccgtacgac
cacgtggccgagcatagtttagtctgtccgcagggccacaacgttgacctttccaagaag
gggatgctgtacttcatgcagcgggccgtagctagcgaatacgatgacgcgatgttggcc
gcccggcggcgaatgctacaggccggcctgtttaccggaatcaccgatgcctttgcggcc
cacctgccggcgacgccccagacgattttagacgtggggtgtggggaagggaccccgtta
gccgccgtgctggcgcaccggaacggtcaagacacggccgtggggtttgacatttcgaag
ccgggcatcaacctggcgacccaactcgagaccaaggcctttttctgcgtggccgatttg
gcgcagatgccgtttaccgaccagcagtttacggcggtgctggatctattttcgccgtcg
gcttacaaggaattcaaccggatcattgcaccgggggggcaactcttaaaggtgattccc
aatgccgattacctgatcgaactgcggcaggccattttcccggccggcaacgcccatgcc
cagtacgacaacagcaatgttttggaacttttcaaacaacattatccacaagccaccagc
gaacggattcgctaccaggtcccggtcgctccggaacggttcgccgatttgatgttgatg
acgccgatgcattggggcgccgatcaggaccggctcgaccaagttgccgcgcagccgttc
cccgcgattacggtcgacgtgacgctactatgtgcacaaccgagcgaggtaaaccgttaa

DBGET integrated database retrieval system