KEGG   Martelella sp. AD-3: AZF01_03015Help
Entry
AZF01_03015       CDS       T04332                                 

Definition
(GenBank) multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
maad  Martelella sp. AD-3
Pathway
maad00230  Purine metabolism
maad00240  Pyrimidine metabolism
maad00760  Nicotinate and nicotinamide metabolism
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AZF01_03015
   00240 Pyrimidine metabolism
    AZF01_03015
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AZF01_03015
Enzymes [BR:maad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     AZF01_03015
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     AZF01_03015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: AMM83456
UniProt: A0A127CF28
Position
complement(670584..672197)
Genome map
AA seq 537 aa AA seqDB search
MHSLSKAALLAASVLSLSAGSALADFQLNILHINDLHSRIEPINKYDSTCSAEEADAGEC
FGGIARVKAAIDGKRGELEGGNLLVLDAGDQFQGSLFYTEYKGAPIAEFMNGIGFDAMAI
GNHEFDDGPEELLNFINAIEFPILSGNTIAADDSVVAGKFDGYTIFDFDGEKVAVVSVLA
TDTGETSSPGAKISFQDEIEYLNKAVPEIEAEGVNKIILLSHVGYKRDQEIAAAVDGIDV
IVGGHSHTLLSSTDEDAAGPYPTMVANPSGEEVPVVTAYAYSKYLGDLAVTFDDDGKVTD
VSGAPILLDASVTPDEAFAARVEELDAPLEELKQQEVGETTAVVVGDRNMCRAEECPMGN
LVADAMLERVAGQGITIAIQNGGGVRASIDEGVVTMGEVLTVLPFQNTIATFQLKGSDIV
AALENGLSKIEEGAGRYPQVSGLKYTYDASKEPGSRVVSVEVETGEDEFAPIDPETVYGV
VTNNYMRGGGDGYAVFADKGMKAYDFGPNLEEAVAEYLGENSPYTPYVDGRITNVAK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcattccctttccaaagccgccctgctcgcggcttccgtgctgtcgctttccgccggc
agcgctcttgccgattttcagttgaacatcctgcacatcaacgatcttcactcccgcatc
gaaccgataaacaagtatgattcgacctgctcggccgaggaagccgatgccggcgagtgc
ttcggcggcattgcgcgggtcaaggcagcgatcgacggaaagcgcggagagctcgagggc
gggaaccttctggtgctcgatgccggcgaccagtttcagggctctctgttctataccgaa
tacaagggcgctccgatcgccgaattcatgaacggcatcggcttcgacgccatggcgatc
ggcaaccacgaattcgatgacgggccggaagaactgctgaacttcatcaacgccatcgaa
tttccgatcctttcaggcaacacgatcgccgcggatgacagcgtcgtcgccggcaagttc
gacggttacacgatcttcgatttcgacggcgagaaggtggccgtggtttcggttctcgcc
accgacaccggcgagacatcctctcccggcgcaaagatctcgttccaggacgaaatagag
tatctgaacaaggccgtgccggaaatcgaggcggaaggggtgaacaagatcatcctgctt
tcccatgtcggctacaagcgtgaccaggaaatcgccgccgcggttgacgggatcgacgtc
atcgtcggcggccacagccacaccctgctctccagcacggacgaggacgccgccggtccc
tatccgacgatggttgccaatccgtcgggcgaagaggttccggtcgttaccgcctatgcc
tattccaaatatctcggcgatctcgccgtcaccttcgatgatgacggcaaggtgaccgac
gtttccggcgcgccgattctgcttgatgcatcggtcacgcccgacgaggcctttgcggcg
cgggtcgaggagcttgatgccccgcttgaggaactcaagcagcaggaagtcggcgagacc
accgccgtcgtcgtcggcgaccgcaatatgtgccgcgccgaggagtgcccgatgggcaat
ctcgttgccgacgccatgctggagcgcgtcgccggccagggcattaccatcgccatccag
aacggcggcggcgtgcgcgcctcgatcgatgaaggcgtcgtcaccatgggcgaggtcctg
accgtgcttccgttccagaacacgatcgccacgttccagctcaagggctccgacatcgtt
gccgcgcttgaaaacggcctctcgaagatcgaggaaggcgccgggcgttatccgcaggtt
tccgggctcaaatacacctatgatgccagcaaggagccgggcagccgggtcgtttcggtc
gaggttgaaaccggcgaggacgagttcgccccgatcgatcccgagacggtctacggcgtc
gtcaccaacaactacatgcgcggcggcggcgacggctatgcggtcttcgctgacaagggc
atgaaagcctatgatttcggcccgaacctggaagaagccgttgccgaatatctcggcgag
aacagcccctatacgccctatgtggacggccgcatcaccaatgtggcgaagtaa

DBGET integrated database retrieval system