KEGG   Martelella sp. AD-3: AZF01_05570Help
Entry
AZF01_05570       CDS       T04332                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
maad  Martelella sp. AD-3
Pathway
maad03010  Ribosome
Brite
KEGG Orthology (KO) [BR:maad00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AZF01_05570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:maad03011]
    AZF01_05570
Ribosome [BR:maad03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AZF01_05570
  Bacteria
    AZF01_05570
  Archaea
    AZF01_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570 YfcL
Motif
Other DBs
NCBI-ProteinID: AMM83891
UniProt: A0A127CGD1
Position
1212766..1213149
Genome map
AA seq 127 aa AA seqDB search
MGKAKAARRLKENEAQAVTRTIRVSPQKLNLVAAMIRGKKVDRALADLEFSQKRVSETVR
KTLESAIANAENNHDLDVDQLIVAEAYVGKSIVAKRFMVRGRGRASRILKPFSHLTIVVR
EVEEEAA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaaagccgcacgccggcttaaggaaaacgaggcgcaggccgttacgcgc
acgatccgcgtcagcccgcagaagctcaacctcgtcgccgccatgattcgcggcaagaag
gttgaccgggccctggccgatctcgaattctcgcagaagcgggtttccgagaccgtccgc
aagacgctcgaatcggccatcgccaatgccgaaaacaaccacgacctcgacgttgaccag
ctcatcgtcgcggaagcctatgtcggcaagtcgattgtcgccaagcgcttcatggtccgt
ggccggggccgcgcttcgcgcatcctcaagccgttttcgcatctgacgatcgtcgtccgt
gaagtcgaagaggaggccgcataa

DBGET integrated database retrieval system