KEGG   Martelella sp. AD-3: AZF01_08275Help
Entry
AZF01_08275       CDS       T04332                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
maad  Martelella sp. AD-3
Pathway
maad00360  Phenylalanine metabolism
maad00362  Benzoate degradation
maad00621  Dioxin degradation
maad00622  Xylene degradation
maad01100  Metabolic pathways
maad01120  Microbial metabolism in diverse environments
maad01220  Degradation of aromatic compounds
Module
maad_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AZF01_08275
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZF01_08275
   00622 Xylene degradation
    AZF01_08275
   00621 Dioxin degradation
    AZF01_08275
Enzymes [BR:maad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AZF01_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm FMN_dh
Motif
Other DBs
NCBI-ProteinID: AMM84356
UniProt: A0A127CHN9
Position
complement(1784578..1785597)
Genome map
AA seq 339 aa AA seqDB search
MTKLYIQDVTLRDGMHAVRHQYDLGHVRAIAEALDEAGVDAIEVAHGDGLTGSTFNYGFG
KCTDEAWISEAAKVVKKAKLTTLLLPGIGTIHDLKRARDMGVASVRVATHCTEADVSAQH
IAAAKEMGMDVSGFLMMSHMNTPEKLAEQAKLMESYGADCVYVTDSGGRLTMKDVAARFE
AYNAVLKPETQRGAHMHENLSLSVANSVVAVEHGSTRVDASLAGMGAGAGNTPIEAFIAV
ANLYGFEHGCDLFKLQDAAEELVRPLQDRPVRVDRETMTLGYGGVYSSFLRHAERAAEAY
GLDTRDILVEVGRRGMVGGQEDMIVDVALDMIKEKELAI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctctacatacaggacgtcacgctgcgcgacggcatgcacgccgtgcgccac
cagtatgatctcggccatgtccgcgccattgccgaggcgctcgacgaggccggcgtcgat
gccatcgaggtcgcccatggcgacgggctgacgggttcgaccttcaattatggtttcggc
aaatgcaccgatgaagcctggatctccgaggccgccaaggtggtgaagaaggcgaagctc
acgacgctgcttctgcccggcatcggcacgatccacgacctgaagcgcgcccgcgacatg
ggcgtcgcctccgtgcgcgtcgccacccactgcaccgaggccgacgtctccgcccagcac
atcgcggccgcgaaggaaatgggcatggacgtctccggctttttgatgatgagccacatg
aacacgccggaaaagctcgccgaacaggcgaagctgatggaaagctatggcgcggactgc
gtctatgtcaccgattccggcggcaggctcaccatgaaggacgtcgccgcccgtttcgag
gcctacaacgccgttctgaagcccgaaacccagcgcggcgcgcatatgcacgagaacctg
tcgctgtcggtcgccaattcggtcgtagccgtcgagcatggctcgacccgcgtcgacgcc
tcgcttgccggcatgggcgccggcgccggcaacacgccgatcgaggccttcatcgccgtt
gccaatctctatggcttcgagcacggctgcgatctcttcaagctgcaggatgcggccgag
gaactggtgcgaccgctgcaggaccggccggtgcgggtcgaccgtgaaaccatgacactt
ggctatggcggcgtctattcatccttcctgcgccacgcggagcgggcggctgaagcctac
gggcttgatacgcgcgacattctcgtcgaggtcggccggcgcggcatggtcggcggccag
gaggacatgatcgtcgatgtcgccctcgacatgatcaaggaaaaggagctggcgatatga

DBGET integrated database retrieval system