KEGG   Martelella sp. AD-3: AZF01_10045Help
Entry
AZF01_10045       CDS       T04332                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
maad  Martelella sp. AD-3
Pathway
maad00010  Glycolysis / Gluconeogenesis
maad00020  Citrate cycle (TCA cycle)
maad00620  Pyruvate metabolism
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
maad01120  Microbial metabolism in diverse environments
maad01130  Biosynthesis of antibiotics
maad01200  Carbon metabolism
Module
maad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZF01_10045
   00020 Citrate cycle (TCA cycle)
    AZF01_10045
   00620 Pyruvate metabolism
    AZF01_10045
Enzymes [BR:maad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZF01_10045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 HlyD_3 QRPTase_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AMM84651
UniProt: A0A127CIK4
Position
complement(2164777..2166159)
Genome map
AA seq 460 aa AA seqDB search
MPIKITMPALSPTMEEGNLSKWLVKEGDSVSAGDVIAEIETDKATMEVEAVDEGTVAKIV
VPEGTQGVQVNALIAILAEEGEDAAEAAKATGGGDAAPAAKEEPKLEAKAEAPKEEKTGD
AVAKGGIPSSDTPVPEPEAPAAPKADGERIFASPLARRLAKEEGLDLAALSGSGPHGRIV
KRDIEKAVSEGVGKAAPKAEAPAGEKAAAAPIPQAQSEDAILKLFEEGSYELVPHDGMRK
TIAKRLQESKQHIPHFYVTVDCELDALLALRSQLNKAAPVKDDKPVYKLSVNDMVIKAMA
LALRDVPEANVSWTESNMVVHKHVDVGVAVSIPGGLITPIIRKAEEKPLSVISNEMKDMG
KRAREKKLKPAEYQGGTTAVSNMGMMGVKDFAAVVNPPHASILAVGAGEKRAVVKNDEIT
IATMMSVTLSTDHRCVDGALAARVLASFKGYIENPMSMLV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaagattacgatgccggcgctttccccgaccatggaggagggcaacctctcc
aaatggctggtgaaggaaggcgacagcgtttcggccggtgatgtgatcgccgagatcgaa
accgacaaggcgacgatggaagtcgaagccgtcgatgagggcacggtcgccaagatcgtg
gtgcctgagggtacccagggcgttcaggtcaatgcgctgatcgcgatccttgccgaagaa
ggagaagacgcggccgaagccgccaaggcgacgggcggcggcgatgccgcgccggccgcc
aaggaagagcccaagctggaagccaaggccgaggcgccgaaggaagagaagaccggggac
gctgtcgccaagggcggcatcccgtcttccgacaccccggttcccgaacccgaggccccg
gcggcgccgaaggccgacggcgagcgcatcttcgcctcgccgctcgcccgtcgtctggcc
aaggaagaggggctcgaccttgcagccctttccggctccggcccgcacggccgtatcgtc
aagcgcgatatcgaaaaggccgtgagcgagggtgtcggcaaggccgcgccgaaggcggaa
gcgcccgctggcgagaaggccgccgccgcaccgatcccgcaggcccagtcggaagacgcc
atcctcaaactgttcgaggaaggctcctacgaactcgtgccgcatgacggaatgcgcaag
acgatcgccaagcgcctgcaggaaagcaagcaacacatcccgcatttctatgtgacggtg
gattgcgaactggacgcgctgctggcgctccgcagccagctcaacaaggcagcacccgtc
aaggacgacaagccggtctacaagctctcggtcaacgacatggtgatcaaggccatggct
ctggcgctgcgcgatgttccggaagccaatgtctcctggacggagagcaacatggtcgtg
cacaagcatgtggacgtcggcgttgccgtttccattccgggcggactgatcacgccgatc
atccgcaaggccgaggaaaagccgctgtccgtcatctccaacgagatgaaggacatgggc
aagcgcgccagggagaagaagctgaagccggccgaatatcagggcggcaccacggcggtc
tccaacatgggcatgatgggcgtcaaggacttcgcggccgtcgtcaacccgccgcatgcc
tcgatcctcgcggtcggcgcgggcgaaaagcgggccgtggtcaagaacgacgagatcacc
atcgcgacgatgatgtctgtgaccctttcgaccgaccatcgctgcgttgacggcgctctg
gcggcccgggtcctggcctcgttcaagggctatatcgaaaacccgatgtcgatgctggtc
tga

DBGET integrated database retrieval system