KEGG   Martelella sp. AD-3: AZF01_10165Help
Entry
AZF01_10165       CDS       T04332                                 

Gene name
ndk
Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
maad  Martelella sp. AD-3
Pathway
maad00230  Purine metabolism
maad00240  Pyrimidine metabolism
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
maad01130  Biosynthesis of antibiotics
Module
maad_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
maad_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
maad_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
maad_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AZF01_10165 (ndk)
   00240 Pyrimidine metabolism
    AZF01_10165 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:maad04131]
    AZF01_10165 (ndk)
Enzymes [BR:maad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AZF01_10165 (ndk)
Membrane trafficking [BR:maad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AZF01_10165 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AMM84674
UniProt: A0A127CIM7
Position
complement(2191405..2191827)
Genome map
AA seq 140 aa AA seqDB search
MAIERTFSMIKPDATKRNLTGAITKVFEENGLRVVASKRVWMAKRDAEAFYAEHKERPFF
GELVEFMCSGPTVVQVLEGENAVLKNREIMGATNPEKADEGTIRKTFALSMGENSVHGSD
APETAAREIAFWFSETEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgcactttttcgatgatcaagccggatgccaccaagcgcaacctgacc
ggcgccatcaccaaggttttcgaggaaaacggcctgcgcgtcgtcgcctccaagcgcgtg
tggatggcaaagcgcgatgccgaagccttctatgccgagcacaaggagcgtccgttcttc
ggtgagctcgtcgagttcatgtgttccggcccgaccgtcgttcaggttctcgaaggcgaa
aacgccgtcctgaagaaccgcgagatcatgggcgcgaccaacccggaaaaggccgacgaa
ggcacgatccgcaagactttcgcgctgtccatgggcgaaaattcggttcacggttccgat
gctccggaaaccgcggcgcgtgaaatcgccttctggttctccgaaaccgagatcgtcggc
tga

DBGET integrated database retrieval system