KEGG   Martelella sp. AD-3: AZF01_16205Help
Entry
AZF01_16205       CDS       T04332                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
maad  Martelella sp. AD-3
Pathway
maad00230  Purine metabolism
maad00250  Alanine, aspartate and glutamate metabolism
maad01100  Metabolic pathways
Module
maad_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AZF01_16205
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZF01_16205
Enzymes [BR:maad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AZF01_16205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AMM85705
UniProt: A0A127CLH1
Position
complement(3492519..3493817)
Genome map
AA seq 432 aa AA seqDB search
MTNVVVVGSQWGDEGKGKIVDWLSERADIVVRYQGGHNAGHTLVIDGVSYKLSLLPSGVV
REGKLAVIGNGVVVDPHALIAEIGRLEAQGVSISPDNLRIADNATLILSLHRELDGMRED
AASNSGTKIGTTRRGIGPAYEDKVGRRAIRLMDLANLETLPAKVDRLLTHHNALRRGFGV
AEIEHAAIMEELTSVADKVLPYRETVWLLLDKKRRAGARILFEGAQGTLLDIDHGTYPFV
TSSNTVAGQAAAGSGMGPGALEYVLGITKAYTTRVGEGPFPTELHDEVGQFLGERGHEFG
TVTGRQRRCGWFDAVLVRQAVATNGITGIALTKLDVLDGLDELKICVAYELDGERVEALP
ASQGAQARVKPVYITLEGWKESTVGARKWADLPAQAVKYVRQVEELIGAPIALLSTSPER
EDTILVTDPFED
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgttgtagtggtcggctcgcaatggggcgatgaaggcaagggcaagatcgtc
gactggctgtccgagcgcgcggatatcgtggtgcgctatcagggcggccacaatgccggc
cacaccctggtgatcgacggcgtcagctacaagctgtcgcttctgccctcgggcgtcgtg
cgcgaaggcaagcttgccgtcatcggcaatggcgtggtcgtcgacccgcacgcgctgatc
gccgaaatcggacggctggaggcgcagggcgtttcgatttcacccgacaatctgcggatc
gccgacaacgcgacgctgatcctgtcgctgcatcgcgagcttgatggcatgcgcgaggac
gccgcttccaattccggcaccaagatcggcaccacgcgccgcggcatcggcccggcctat
gaggacaaggtcggccgccgggcgatccgcctgatggatctcgcaaaccttgaaaccctg
ccggccaaggtcgaccgtcttctcacccatcacaacgcgctgagacgcggtttcggcgtg
gccgaaatcgagcatgcggcaatcatggaagaactgacctcggtcgccgacaaggttctt
ccctaccgcgaaaccgtctggctgctgctcgacaagaagcgccgcgcaggtgcgcgcatc
ctgttcgaaggcgcgcagggcacgctgctcgacatcgaccacggcacctatcctttcgta
acctcgtcgaatacggttgccggccaggccgcagccggttccggcatgggcccgggcgcg
ctcgaatatgtgctcggcatcaccaaggcctatacgacccgcgtcggcgaggggccgttc
ccgaccgagcttcatgacgaggtcggccagtttcttggcgagcggggccacgaattcggc
acggtcaccggccgtcagcgccgctgcggctggttcgacgccgtcctggtgcgtcaggcc
gtcgccaccaatggcatcaccggcatcgcactgaccaagctcgatgttctcgacggtctc
gacgaactgaagatctgcgtcgcctatgagcttgacggcgagcgggtcgaggcgctgccg
gccagccagggcgcgcaggcacgcgtcaaaccggtctacatcacgcttgagggctggaag
gaatcaaccgtcggcgcgcgcaaatgggccgaccttcccgcgcaggccgtaaaatacgta
cggcaggttgaagagctgattggcgcaccaatcgcgcttctatccacaagtcctgagcgc
gaagacaccattcttgtgaccgatccgtttgaggattaa

DBGET integrated database retrieval system