KEGG   Martelella sp. AD-3: AZF01_17680Help
Entry
AZF01_17680       CDS       T04332                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
maad  Martelella sp. AD-3
Pathway
maad00010  Glycolysis / Gluconeogenesis
maad00020  Citrate cycle (TCA cycle)
maad00620  Pyruvate metabolism
maad01100  Metabolic pathways
maad01110  Biosynthesis of secondary metabolites
maad01120  Microbial metabolism in diverse environments
maad01130  Biosynthesis of antibiotics
maad01200  Carbon metabolism
Module
maad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:maad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZF01_17680
   00020 Citrate cycle (TCA cycle)
    AZF01_17680
   00620 Pyruvate metabolism
    AZF01_17680
Enzymes [BR:maad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZF01_17680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding DUF5555 DUF111
Motif
Other DBs
NCBI-ProteinID: AMM85953
UniProt: A0A127CMM4
Position
complement(3823343..3824251)
Genome map
AA seq 302 aa AA seqDB search
MSDKDFIASPAVVAYAGRKGIDLSDVARKSGRTNLAREDVDQHLDGSAPVVGGTASADDR
RYWDIDHAAYGPVSEEPMTRIANLAADNLSAANRMIPQVTHHDRADMRALEAFRTSLKAE
ASAKGLRLTALAFHIKALALTLKAFPLFNSSLSADGKVLIRKDYCHIGVAVDTPHGLMVP
VIRDADRKGLWQISAEIADLAKRAGDRKLRPDEMGGASMSVSNLGGIGGTAFTPLVNPPE
VAILGITRAETVPVWENEAWQPVLMAPLDLSYDHRVINGADAARFLCHYARLLADPRRML
FA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaaggatttcatcgcaagcccggccgtggtggcctatgccggacgcaagggc
atcgacctttccgatgttgcgcgaaaatcgggtcgcaccaatctggcgcgcgaggatgtc
gaccagcatctggacggctccgcaccggttgtcgggggaaccgccagcgcagatgaccga
cggtactgggatatcgaccatgcggcttacggacccgtcagcgaagaaccgatgacgcgg
atcgcaaaccttgccgccgacaatctttcggccgccaaccggatgatcccgcaggtcacc
catcacgatcgcgccgacatgcgcgcgctcgaagcctttcgcacgagcctcaaggcggaa
gcttcggccaaagggctgaggctcaccgcgcttgcctttcacatcaaggcgctggcgctc
accctcaaagcctttccgctgttcaattcatcgctgtcggcagacggcaaggtgttgatc
cggaaagactattgccacatcggcgtcgccgtcgacacgccgcacgggctgatggtgccg
gtgatccgcgatgcggaccgcaagggcctgtggcagatctccgccgagattgccgacctg
gcgaagagggccggcgaccgcaagcttcggcctgacgaaatgggcggggcgtcgatgtcc
gtttccaatctcggcggcatcggcggcacggcgttcacgccgttggtcaacccgccggaa
gtggccattctcggtatcacgcgagcggaaaccgttccggtctgggagaacgaggcctgg
cagcctgtgctgatggcgccgctcgacctttcctatgatcaccgggtgatcaacggcgcg
gatgccgcgcggttcctctgccattatgcccggcttcttgccgatccgcgccggatgctc
tttgcctga

DBGET integrated database retrieval system